Open Close
General Information
Symbol
Dmel\tws-PF
Species
D. melanogaster
Annotation Symbol
CG6235-PF
FlyBase ID
FBpp0081665
Associated gene
Length (aa)
499
Theoretical pI
7.10
Predicted MW (kDa)
57.0
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MGRWGRQSPVLEPPDPQMQTTPPPPTLPPRTFMRQSSITKIGNMLNTAININGAKKPASNGEASWCFSQIKGALDDDVTD
ADIISCVEFNHDGELLATGDKGGRVVIFQRDPASKAANPRRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLQQKNP
VHFLLSTNDKTVKLWKVSERDKSFGGYNTKEENGLIRDPQNVTALRVPSVKQIPLLVEASPRRTFANAHTYHINSISVNS
DQETFLSADDLRINLWHLEVVNQSYNIVDIKPTNMEELTEVITAAEFHPTECNVFVYSSSKGTIRLCDMRSAALCDRHSK
QFEEPENPTNRSFFSEIISSISDVKLSNSGRYMISRDYLSIKVWDLHMETKPIETYPVHEYLRAKLCSLYENDCIFDKFE
CCWNGKDSSIMTGSYNNFFRVFDRNSKKDVTLEASRDIIKPKTVLKPRKVCTGGKRKKDEISVDCLDFNKKILHTAWHPE
ENIIAVAATNNLFIFQDKF
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0082187
3664
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0082186
2520
FBtr0082188
2896
FBtr0082191
2242
FBtr0082189
3086
FBtr0082190
3819
FBtr0082192
2400
FBtr0082193
2300
FBtr0345177
3856
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0081664
499
FBpp0081666
443
FBpp0081669
443
FBpp0081667
443
FBpp0081668
443
FBpp0081670
443
FBpp0081671
443
FBpp0311386
499
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/Swiss-Prot - Manually annotated and reviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG6235-PF
Name Synonyms
Secondary FlyBase IDs
    References (2)