Open Close
General Information
Symbol
Dmel\Bruce-PA
Species
D. melanogaster
Annotation Symbol
CG6303-PA
FlyBase ID
FBpp0081717
Associated gene
Length (aa)
4876
Theoretical pI
5.26
Predicted MW (kDa)
539.2
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MATEQHHQQRVLKQDGYLDLGDCNSAPSRPFEMRNVVYHPQLNVLLLFDNGSTVKVLDANSGVILQTYHLSSNGDSIVHG
RYMPLQDKILFWDGHNLGLRGDYNGVLLLDTILQAPIGQNDDYIKLEIILSEAIIFQNCITELESEGLECPCDISNELTQ
KINQAQLKAKKGIKAQRWNTICLEVPYSSLKLVSNNMVILLKRLERHIPVLAIASAINERLTDMMMGSRVPDFGWNFSNF
QRVLMHSEAVRRQTFEKWPHMDYKWALPDQMAQAGFYHQPSSSGEDRAMCFTCSVCLVCWEKTDEPWSEHERHSPLCPFV
KGEYTQNVPLSITYATNPALPAPGLGFDIISNSDYANVLCTSCSQTGELSVWSIERHLKLMHTFHVPTLLNYIFEESFEW
ARVTAICVLPNARARTKVNYVYSAANYGGSGSSNGAGCNSGLNAVSGGKFGSVNAQHITSTSTLRAGVVGSKIVLGVSVR
QSSGELALRMVVLNIVEVDRNSESSTSVSNDSGSVSSGGGQLMKSSSPMVNVSAENNATVTQVNLESKDDDNKAMTPYEK
FADGFDSNGFVSALMTYNKNNGVSQNTDDASALYDFDLCTLSQILDHNLEEPLSLMVGSSNTVNVSNIGMGNEINKLVVD
VEISHQNNNNNNNNNNEASSLGGNSSNNNNNIMINGGTNSSIDKMTAIEEIDCVVESWTSVKRMNALDGASSGVNGVNHM
DQEVIEIAEILPTTPKCNQLLVKLLRTKAPEAEGSKIIMATVAKEEEEEDEEQRTDESMETDNNAEGNVAAQLLVFDYDD
TEISNDYTLAMTFSRAKFPKQLCILPHFNSSPEHKDAGSICVVCADGTVEIYSLADFQGTMVIEEEGEHFESVVYCRNLD
RLCCCSRQGGLLFYSLSDGENDSGDELLEMDDDCSTTLTQAADVSVTDGGRQLARTDLLGKTLLANESICMDAGSEAAAI
PNSSSAAQGAHVQTSPSASSAPSTNANLLAYKTADLTLEDLKVFYALTQFDDKLTVYSAEVPSCWNDIGQVQNQRKQSQN
MRHGGDERDFTRTWRLHNDATTWDEHIIELNLAQPVSLGHIDLKFTVYQQCSNPAAIQVTLLKQNNNGFGYRMKGPHSSY
KPNVIDDNIDLSYIANENPVLSEEYLLAHNAEVLAGPIELSSCIDLCDQGGTATLTSPKLFKTRTRNFLLHIKTVSDPSK
DGQNKTRGCDWLHEISISVRAVKSHSRISNGRMQRIAMLESNVLLVQLLRIASDPASSSLAKNLSLDILNWICFIRLNRF
RSPKSERLKDQINKQTAANIQDLLAQQFECISLAEKHIEQLLRNCVIYSERSTAHKCVKLLIMLTEGATNLPAEVQDHTT
LDYSFKAAIANTFPELPRAQCGSVVRWYMMLTCATSTAESHNSISEQAISLLKEIAAEIDKRWDPHCALLCTRFGLYGYP
FEPEIFDFDFPNVSRQGPGSSVANVIRSSPTILPVTGLDIKRLSSIDGVDFRTFPYLIRGKSISNQLRGLLEVVQLHFNC
VQTSEATRIDNIDSVGGNTGANVIIEDVMMMPKQVVAKEKGEEMLNDLVNDVECLVEEMKVDENEKQEKVDYDAFGLVNG
FKDKTLSSLNSVKQTLKEEVKKEKADIMDKLTIAKFLPKLSLLESYMQKKINEHISFDDFGKLDNWDGNTTPPFNLEVEA
PIVCSEATSESNMSQQATSAGGNILDDAADSEKITESLNANPCQPIAWHKLITPPPKQMIVIDRMHSGARRFVVLDFGQH
ILLTDLVIPSCDELTSLNIDIWCFDEETDCTRLVQVNDIQTKTLVLSDIQPAPICRYLKLTIIGRIGMSATKCKVPLGRF
FGHPVVLEHDGYGDQLMKYIKHPTHSLQSQIKSLNALYEDVHCRYSLASSKLMDLLAPMRNSELSNVAHLQAFINKQREE
ELSGLENNNKVVSLYDECMLLQYQINVIRNVVLRLERALSPNSPTTTLLPGQSIPLTEDILRAASRDKLRVLSLSLVEVL
LHFSIEYGIKNILPVHQRFNAATAKALFNALVVYGDAQLQLATCSLLVRMCCFQPWWGDFLADTFCSLFSAQNCKAFPQD
RIFFLLTYLGRRSIAMGACRSIVIDAVLKTLVKLLAPISPHYKFQSEQPSTSANAADRNAAMGTTSDLQLITWLLLFLSV
CLDDNERKDKSAARWDFMSCEGDFTKARPSATPNIKQLRCFKKRIIQQNKYLAQPYADWGKKIYMIQNEHPGIFMELSTK
SKGAGPTKSTSTGGKINMGSSGLCVGGPSSSSGNTSKSAASSSSPKNQAVPGTDGERDSNFDKGLKSLRMDNIKVVIRGL
FALLLEMDFDCNMDQFLLTCKVIARLVAACRPSVQLCKIVTIAQLQQLVRLSVWNDQQHPWAVHAITCLLQDLLDADKQF
RDNDVTPTNDTPRTMEAAIQETRDLFSDYTSTASSCTEALFETLMPTAREFYQEAVKYNYLPSLIECDDTEFDEMLNDID
MIERTKPVTKKESNALSKNTFNFFCKSISIALDSRLDVGLELHVETQLRRLTNRTSLDLYSSLPQVLTNEFVSPPPEAAP
WPEYLTQLWSGTEYNGDNTYVMFKRVFDSILAELHLEDTWVHLEQVLQMWLTLNCELSDKPYTSGITHSDVPKIPFGANA
VQGLLLALAWHSDIKLRTWCLGFQCLFLACNSLPIGDDADCTRINEAIVNDENFEKVLLRFFSGYGMSSSIITNRCAGPT
ICKHLHELLLWLHSKSETSGIPCKRRLKDILLHVVLQLVQPGGSISNQQGPIDAQNQLVRDLLMMPNDKGDLNIALKITE
SVSFLVYNNISNGERLQCQRGNENSPVGNNFSNLFANVLGSENPNKQNAAICDNSLIINLLKLSSHMVLTEMPRQPSEVT
IPEEEELSNQSQTDETKAEQLNTEGHRSKVPCIADWVLRHFPTMKRLFGTLSQCSTNTFTMMSSGCFFSPKSNMILDDPQ
TIADAVFSLMITLNDKASHPRLVVVPICRYLEETTIPRNATLPRLPHSEPFLWYISKVLEVPAAVQTFTQLGGIQIICHS
LVRLNKTIINMQPGLISLIMQHLTRNTRFKRNNHVAASSACKKTTTGTGTTCPTSAQPPRSAAQYDGLINFAPFSHIVSE
NDATQSAEVLISNPNNSHRRPRSPAWTYMFYPNETHVDLTITLPTAILLKEVQLVPHTTSLASCPSAVALELSRDYGLGS
IPVGAPMATTGLTCIRLKLAKAEVATSIVLRLYKPKDCGNVGLVQIAVLGQTIFGNRMHGLRSPSPFIDSLATCSSPVQT
AVLAAMDADSMLEDDAFAKTSIGWVRILSRCFHVAALQPDSKLADLIAAYPAAYPGFLEACCSLLNIMPMIPSLAQQHLE
TILLKLSAYNHEISLQLLRTLLWHTTPQVFKLSSDSVCDLIYEVVTGSTEHLLDKLRVLIDWVMQLHDNYSKQARCNNPQ
SGFVKVIASILWKVHTQQQLPELPLLISSSLFETCFEWVSSLEHDEPLKSSFDSLLCALCFIKPELFNQLLVKLGVKLEP
PARGQTDDSKVQSGSAWFRREGSENLSVLLQRPTFLKTLALACQSPAAVYQMLDSGLPKLLAHAIYEYCMHLMPGSEPVA
SASTVPEDEPLANNQAAAAADDEDSSLTDFDKAEANVVYNTPLLSSSNVPKVLDFFAECCAEGPMRDWLGTMQGSVFWKP
LLQLLCNTHAAQFSKTLPKEQSFIRLERATINFFTRVSACHPGNQENLTSLLIGAIICKPLRFSHGVRPTISGFTRQMVL
QLLLENEHITVSVRSQQPLQRRDTLSAVLGGISSGASTSLPVAAVNNHPARRSSAHHMLFTVTTSTTCQEIMQNCVSVFS
NLVYQQPTDQRAGETSASSSGVSSATAKSSESKMEKSSFLNFNNVEAGSMEFLTVGAAVAAKDKRIKDAKNQAAMNKDKE
TQTSSTNLASNIFNVDEFLLQSANAVNGNQLVIPEYSDIVLAGDATISQVLASLQNAGHSLSTPCISFDLVLQQRSDDTS
EAKKTKAACTEPLPSPLQRFSSSGGLSLLAHYLPTVYPEHSGRKTTLVFSEKEKSPPLSDWVKLEPNDEIYEDLEDTLCE
PAAKLATVSSVPQHSLAAFGLFLRLPAYSDVLLRDKMRAQCLLRLVLGVTGDGDGNDIYSLSLAPSLPTLPFEVFRQLLD
SVPLSTDDGVLLRRVVIEVGAMHLVLNCLGIFSHQSHNNRIGAPISEPSPSGTSSGSGTIGNGSGNGSVSGTKTNAPEEA
TPSATSDDKSHMYWAKGTGFGTGSTTQSWNVEQALLRQKSEEEHVTVLLLVLASYINPGDCIPSEMCGEDILAYHDVRDV
TGELPPIFQTLLQQSCLIPALSSYLRNDSVLDITRHIPLYRAILKLLRALSLSKMLVSLLQPSASGSGDSTPPIVELLTS
MKTCVDTYAKRLKVNKKSNIKGQTHQLTFNIDDGDDEGLALLIPDIHETSVLVQKTTDADALINMLHTNEDGSAQLEPQS
KSIEQRYLELMKKRQFDTFDMIVESDNNSFRFVVSHHFEKMVRLAGDRYHPSRVKRLAQEAVTLSTSLPLSFSSSVFVRC
DTDRLDIMKVLITGPADTPYANGCFEFDVFFPPDYPNQPMLINLETTGRHSVRFNPNLYNDGKVCLSVLNTWHGRPEEKW
NAQTSSFLQVLVSIQSLILVPEPYFNEPGFERSRGSPSGTNSSREYNSNIYQACVRWAMLEQIRSPSQCFKDVIHKHFWL
KREEICAQIEGWIEELGKPQYTERASRTISFNSMVLRRHYRHLREELSKLKPPRGLEDLDAPFNPVATLPPMDVSAVAPS
LAATNTVQAQPDDAIVTDITLLGENADECEADGDAEGDGEVDDGFKGFPQEEGLLTGEEEVVEILSDTENESSMWQ
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0082239
15402
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0331681
15702
FBtr0331682
15330
FBtr0331683
15399
FBtr0331684
15369
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0304070
4976
FBpp0304071
4852
FBpp0304072
4875
FBpp0304073
4865
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
Bruce-PA
CG6303-PA
Name Synonyms
Secondary FlyBase IDs
    References (2)