Polypeptide Dmel\Jupiter-PA

General Information
Symbol	Dmel\Jupiter-PA	Species	D. melanogaster
Annotation Symbol	CG31363-PA	FlyBase ID	FBpp0081932
Associated gene	Dmel\Jupiter

Length (aa)	197	Theoretical pI	10.58
Predicted MW (kDa)	20.9

Map ( GBrowse )
Recent Updates
Description	What does this section display? This section contains items that were added to this record for each release. It currently only tracks new links between this FlyBase report and other FlyBase data classes (e.g. genes, references, stocks) or controlled vocabulary terms (e.g. GO, anatomy terms). What does this section not display? This section does not currently display links that were removed or gene model changes.
Update Feed	Click the icon below to subscribe to this FlyBase record and receive updates automatically through your feed reader.
FB2013_03
FB2013_02
All updates	Click here to see a list of all updates to this record from FB2010_08 and on.
Sequence
	MISNFDCTDNQASSKVLRPPGGGSSDIFGSEMPQTPRNVKNRMASNIFAA EKDNGVKNNGDAPRRGQKTVDSHSRLFGEPTRPITPGKNHMKSSIPFGQN TEAVAAQKLLTTNGHYNGKSGSVSSASSSVSSSTENLKMNSGSRSVFRNM SKGNPVTGEGYKVVANEYSQRQESSNGGTPVINKNRIPPGGYSSGLW
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide	Name FlyBase ID Length (nt) Jupiter-RA FBtr0082456 1535
Corresponding to OTHER polypeptides	Name FlyBase ID Length (nt) Jupiter-RB FBtr0082457 1583 Jupiter-RC FBtr0082455 1581 Jupiter-RD FBtr0082452 1517 Jupiter-RE FBtr0082454 1658 Jupiter-RH FBtr0082453 1550 Jupiter-RI FBtr0335232 1259
Other Polypeptides
	Name FlyBase ID Length (aa) Jupiter-PB FBpp0081933 185 Jupiter-PC FBpp0081931 197 Jupiter-PD FBpp0081928 191 Jupiter-PE FBpp0081930 208 Jupiter-PH FBpp0081929 202 Jupiter-PI FBpp0307219 105
External Crossreferences
	RefSeq - An integrated, non-redundant set of sequences • NP_731596 DDBJ / EMBL / GenBank • AAF54661
Synonyms
	CG31363-PA Jupiter-PA
References ( 1 )
FlyBase analysis	FlyBase, 1996-, FlyBase inference based on genome sequence analysis. FlyBase inference based on genome sequence analysis. [FBrf0104946]