Polypeptide Dmel\CG33098-PD

General Information
Symbol	Dmel\CG33098-PD	Species	D. melanogaster
Annotation Symbol	CG33098-PD	FlyBase ID	FBpp0082050
Associated gene	Dmel\CG33098

Length (aa)	164	Theoretical pI	4.38
Predicted MW (kDa)	18.9

Map ( GBrowse )
Recent Updates
Description	What does this section display? This section contains items that were added to this record for each release. It currently only tracks new links between this FlyBase report and other FlyBase data classes (e.g. genes, references, stocks) or controlled vocabulary terms (e.g. GO, anatomy terms). What does this section not display? This section does not currently display links that were removed or gene model changes.
Update Feed	Click the icon below to subscribe to this FlyBase record and receive updates automatically through your feed reader.
FB2013_03
FB2013_02
All updates	Click here to see a list of all updates to this record from FB2010_08 and on.
Sequence
	MRADDNVAPHELDIAKLAELKEVFSLFDTDCDGLISKDDLRFTYTALGNE PNEQLLEQMMQEAKEPLDYEAFVRLMSRRTQELDPEDVLLEAWSKWDDHG TGKIDERKIYEELTNYGDKMTLNEAKEALSHAPMAKPKSLEEPPMIDYPA FCRMLSGMRKRKGE
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide	Name FlyBase ID Length (nt) CG33098-RD FBtr0082578 848
Corresponding to OTHER polypeptides	Name FlyBase ID Length (nt) CG33098-RB FBtr0082579 1049 CG33098-RC FBtr0082580 902 CG33098-RE FBtr0332161 1170 CG33098-RF FBtr0332162 1183
Other Polypeptides
	Name FlyBase ID Length (aa) CG33098-PB FBpp0082051 230 CG33098-PC FBpp0082052 199 CG33098-PE FBpp0304470 230 CG33098-PF FBpp0304471 230
External Crossreferences
	RefSeq - An integrated, non-redundant set of sequences • NP_788659 DDBJ / EMBL / GenBank • AAO41562
Synonyms
	CG33098-PD
References ( 2 )
FlyBase analysis	FlyBase Genome Annotators, 2004, Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. [FBrf0166453] FlyBase, 1996-, FlyBase inference based on genome sequence analysis. FlyBase inference based on genome sequence analysis. [FBrf0104946]