Open Close
General Information
Symbol
Dmel\Hsp70Bb-PA
Species
D. melanogaster
Annotation Symbol
CG31359-PA
FlyBase ID
FBpp0082106
Associated gene
Length (aa)
641
Theoretical pI
5.49
Predicted MW (kDa)
70.2
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MPAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMNPRNTVFDAKRLIGRKYDDPKI
AEDMKHWPFKVVSDGGKPKIGVEYKGESKRFAPEEISSMVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGH
IAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDTHLGGEDFDNRLVTHLA
EEFKRKYKKDLRSNPRALRRLRTAAERAKRTLSSSTEATIEIDALFEGQDFYTKVSRARFEELCADLFRNTLQPVEKALN
DAKMDKGQIHDIVLVGGSTRIPKVQSLLQEFFHGKNLNLSINPDEAVAYGAAVQAAILSGDQSGKIQDVLLVDVAPLSLG
IETAGGVMTKLIERNCRIPCKQTKTFSTYSDNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDLDA
NGILNVSAKEMSTGKAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEKHRQRITSRNALESYVFNVKQSVEQAPAGKLD
EADKNSVLDKCNETIRWLDSNTTAEKEEFDHKMEELTRHCSPIMTKMHQQGAGAAGGPGANCGQQAGGFGGYSGPTVEEV
D
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0082637
2347
Corresponding to OTHER polypeptides
Other Polypeptides
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/Swiss-Prot - Manually annotated and reviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG31359-PA
Hsp70Bb-PA
Name Synonyms
Secondary FlyBase IDs
    References (2)