Open Close
General Information
Symbol
Dmel\Lkb1-PI
Species
D. melanogaster
Annotation Symbol
CG9374-PI
FlyBase ID
FBpp0082283
Associated gene
Length (aa)
567
Theoretical pI
5.58
Predicted MW (kDa)
62.9
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MQCSSSRPVGGKAAGGAEAGGAGATGQMTVTTMEAQVKAAHHHHLHHPTGGGAQHKVEEEEPDPVEDEMTVLLANKNFHY
DVASDLDDDAFVELKEDTAQADDAGAGVGFYNPDELLLDDQPHPQVTWLDDDEIETLDRVTLDMGNMFFNRVDSQDIIYQ
QKKKSIKMVGKYIMGDVLGEGSYGKVKEAMNSENLCRLAVKILTKRKLRRIPNGEQNVTREIALLKQLKHRHVVELVDVL
YNEEKQKMYLVMEYCVGGLQEMIDYQPDKRMPLFQAHGYFKQLVDGLEYLHSCRVIHKDIKPGNLLLSLDQTLKISDFGV
AEQLDLFAPDDTCTTGQGSPAFQPPEIANGHETFAGFKVDIWSSGVTLYNLATGQYPFEGDNIYRLLENIGRGQWEAPAW
LYEMDADFANLILGMLQADPSKRLSLQEIRHDTWFRSAPVKTGPPIPIPPLKGDKYRNSTVIPYLEAYHYGTQEEDVYFT
EHDVNQELARQAAAAASEIRAKQSAAALAACHTYEPPSTSAAAASNSLGNGSREEAPVKKKGSALKRRAKKLTSCISVRK
LSHCRTS
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0082815
2403
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0082808
2428
FBtr0082809
2397
FBtr0082810
2391
FBtr0082811
2422
FBtr0082812
2553
FBtr0082813
2407
FBtr0082814
2401
FBtr0301488
2487
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0082276
567
FBpp0082277
567
FBpp0082278
567
FBpp0082279
567
FBpp0082280
567
FBpp0082281
567
FBpp0082282
567
FBpp0290703
567
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (3)
Reported As
Symbol Synonym
CG9374-PI
Lkb1-PI
Name Synonyms
Secondary FlyBase IDs
    References (2)