Open Close
General Information
Symbol
Dmel\CG14853-PA
Species
D. melanogaster
Annotation Symbol
CG14853-PA
FlyBase ID
FBpp0082420
Associated gene
Length (aa)
374
Theoretical pI
3.83
Predicted MW (kDa)
38.7
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MSNLLYMDKSNGNGVYAVRPNSSNGHMDNDNGLNGSGAPATTSTTTGTATAAGAALMATANNINIMNGAAAAAAASASGL
PTSASSEDLSQSLSEYTDADESVSAPTEFLAEFLSAVMLKDYKKALKYCKLILQYEPDNATAKEFYPLILDKLRAVATSS
DSDENYNKSSSPDLALDLHASDVEADVDGDEAGDADEDGDADADGDGSESSNNCSEEEDNGWGDDEIDNVDVMDGEEESS
SSGDDFDLPIDDAGQDPAALAVHVHHSHTHSHSHSHNDSGSSRNSSSGGGGRSDNTTHSYSSLLLEEEDDIVPVSLNFGL
KENTAADLDVSNGNKVPSASCSDSESPTEPLTQRLAAILRSKCGVSGGGSDETY
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0082961
1813
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0082960
2617
FBtr0334028
1951
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0082419
374
FBpp0306145
374
External Crossreferences and Linkouts ( 4 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CG14853-PA
Name Synonyms
Secondary FlyBase IDs
    References (2)