Open Close
General Information
Symbol
Dmel\CG5316-PA
Species
D. melanogaster
Annotation Symbol
CG5316-PA
FlyBase ID
FBpp0083173
Associated gene
Length (aa)
139
Theoretical pI
10.53
Predicted MW (kDa)
16.0
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MSWSSALIKDISKPENLIISSEIAVVIADKFPKAQHHYLVLPLADIPSIFHLNRSHLSLLEELHLLARNVVEVKGVRWQD
FNVGFHAEPSMQRLHLHVISKDFVSTSLKTKKHWNSFNTELFVPYTSKAIRTRRRLQAS
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0083759
2610
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0083760
2483
FBtr0083758
2376
FBtr0445726
2553
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0083174
662
FBpp0083172
662
FBpp0401601
443
External Crossreferences and Linkouts ( 4 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CG5316-PA
Name Synonyms
Secondary FlyBase IDs
    References (2)