Open Close
General Information
Symbol
Dmel\CG6231-PA
Species
D. melanogaster
Annotation Symbol
CG6231-PA
FlyBase ID
FBpp0083220
Associated gene
Length (aa)
585
Theoretical pI
7.15
Predicted MW (kDa)
65.6
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MDFDQILAKCGDFNRYQFMILALFGFINIIVSMHYFTQTVISFVPDHWCYHDKLVNMTYKEIGEIYAQFENPSCTRLDDI
NGHNVTVSSKACEKWIYNYDFGYRSMNTELNWVCDSAYKARIGQSLFFIGSVVGTLFYGLLSDKIGRVPALILSNFCGFA
GDFSTIFTKSVATFTLCRFISGLAADTNFYLMYIIVLEYIRPSMRTLGLNMAVGLFYCLGLVFTPWLAVLVGHWQIYLAC
TSLPILLVVLYYFVVQESAQWLVTRNDIDGAIVRLKRVAKFNGCRVSQADFDEFRRHCQMTHEMLGGDDKKQATLLDMFR
TPRMRKNTLILFFKSMVITLCYDAVSRNVEGMGISPFIMFSLSALAVLPSSVLLVLLQDRIGRKGMASGSLLVGGLFTAA
AGIAIAYQQHNHNAILLACLTIAARFGVAISYESGSQYATELIPTCVRGQGVAAVHVAGFAASFLAPYILWLGTFFKAAP
SIILGVLFFAGSFVCLLLPETLNRSLPTTIEEGEVFGKGERMFDFPCLHNKHDDEESESELEKYKRKHSLIDAKQMQMES
CSNGKRKQSLIDADHEEQALKDANH
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0083810
3096
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0083809
2804
FBtr0083807
2954
FBtr0083808
2884
FBtr0334923
2720
FBtr0334924
2730
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0083219
585
FBpp0083217
585
FBpp0083218
585
FBpp0306943
585
FBpp0306944
585
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CG6231-PA
Name Synonyms
Secondary FlyBase IDs
    References (2)