Open Close
General Information
Symbol
Dmel\MICU3-PA
Species
D. melanogaster
Annotation Symbol
CG4662-PA
FlyBase ID
FBpp0083223
Associated gene
Length (aa)
497
Theoretical pI
7.39
Predicted MW (kDa)
57.4
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MAGLAARLTVKNCTIIAQRSSVIVGVGRSARFSSSSSQMGRIPGHKTRRLLTIVGGSAVSLAALAAFIKLRSAENPVNAV
SLKRRMRDDSELENVKLTARERRFIKFASVEYDDQLYMTPQDFLDSVVEQEPRPRLKRRQLSSDEVDKYKENTPALKKGS
TRLFRNLRDKGIVSYTEYLFLLSILTKPKSGFRIAFNMFDTDGNQRVDKDEFLVIISILAGALKDTQNVDPQTKRIMERI
FSGAWKEKHGEQEPEEELATPTPLENYVNDGEGLQRRHMVATTLQLHFFGKRGTGVINYDNFYRFMDNLQTEVLELEFHE
FSKGNSVISELDFAKILLRYTYLATDEYDVFLERLLERVKDEKGISFHDFRDFCHFLNNLDDFTIAMRMYTLADRAISKD
EFSRAVKICTGYKLSPHLIDTVFAIFDADGDGLLSYKEFIAIMKDRLHRGFKVSGRFFDYNEALDAYDEPDYPLFVAWRH
RVCRHLDYFIDSDALWH
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0083813
1830
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0083814
2279
FBtr0301116
1754
FBtr0335008
1911
FBtr0335009
1821
FBtr0335010
1841
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0083224
479
FBpp0290338
476
FBpp0307016
524
FBpp0307017
494
FBpp0307018
505
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG4662-PA
MICU3-PA
Name Synonyms
Secondary FlyBase IDs
    References (2)