Open Close
General Information
Symbol
Dmel\XNP-PB
Species
D. melanogaster
Annotation Symbol
CG4548-PB
FlyBase ID
FBpp0084213
Associated gene
Length (aa)
1311
Theoretical pI
8.66
Predicted MW (kDa)
148.2
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MGKKNPNARHTDAATPLTTDDSNSSSVSRRESATESKSASESESSPPRSNTKQSRTHKNVKASGKATVSSSSDSDQAVAN
SSANDEEKEPVCKIRIVPLEKLLASPKTKERPSRGSQQKNVTINDSSDEEPLKGSKLVLPARKSRNKNASIIELSDSEEV
DEEEESLLVAIPLPKEAQQTKPEKNSSKASKESIEKRQKAQKEATTSSARAIRSVNGTRRGSLSSERSSRASSSRAESPP
RPKRCVVRLKRVSLPKTKPAQKPKKMSSDSEEAATTSKKSRQRRSKSESEADSDYEAPAAEEEEEEERKSSGDEEEAANS
SDSEVMPQRKRRRKKSESDKGSSDFEPEEKQKKKGRKRIKKTSSGESDGDGDDDKQKNKRKHIRKIIKTKDLDLTTKEAA
KEEDDRRKRIEDRQKLYNRIFVKSESVEINELVLDFDEESKKALLQVDKGLLKKLKPHQVAGVKFMWDACFETLKESQEK
PGSGCILAHCMGLGKTLQVVTLSHTLLVNTRRTGVDRVLIISPLSTVNNWAREFTSWMKFANRNDIEVYDISRYKDKPTR
IFKLNEWFNEGGVCILGYDMYRILANEKAKGLRKKQREQLMQALVDPGPDLVVCDEGHLLKNEKTSISKAVTRMRTKRRI
VLTGTPLQNNLREYYCMIQFVKPNLLGTYKEYMNRFVNPITNGQYTDSTERDLRLMKHRSHILHKLLEGCIQRRDYSVLA
PYLPPKHEYVVYTTLSELQQKLYGYYMTTHREQSGGDVVGKGARLFQDFQDLRRIWTHPMNLRVNSDNVIAKRLLSNDDS
DMEGFICDETDEDEAASNSSDSCETFKSDASMSGLAASSGKVKKRKTRNGNAGGGDSDSDLEMLGGLGGGSSVQKDDPSE
WWKPFVEERELNNVHHSPKLLILLRLLQQCEAIGDKLLVFSQSLQSLDVIEHFLSLVDSNTKNYEFEGDVGDFKGCWTSG
KDYFRLDGSCSVEQREAMCKQFNNITNLRARLFLISTRAGGLGINLVAANRVVIFDVSWNPSHDTQSIFRVYRFGQIKPC
YIYRLIAMGTMEQKVYERQVAKQATAKRVIDEQQISRHYNQTDLMELYSYELKPSTEREMPILPKDRLFAEILTEHEKLI
FKYHEHDSLLEQEEHENLTEEERKSAWAEYEAEKTRTVQASQYMSYDRNAFGNQVMGQFGNASGSVTSNKIFGFRSDILL
QLLNMKISKDHQELNQNQVIQLVPTYLQQLYNEMNNGDPTMYKDLLNLHSNIVHPSGMYMNPLLYANQNPNAAGYNQGTG
GVPPMAGGSVAHGPPAAPAPGFEPDKVYEID
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0084838
4557
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0084837
4493
FBtr0344718
4493
FBtr0344719
4557
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0084212
1311
FBpp0311051
1046
FBpp0311052
1046
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/Swiss-Prot - Manually annotated and reviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG4548-PB
Name Synonyms
Secondary FlyBase IDs
    References (2)