Open Close
General Information
Symbol
Dmel\Lnk-PA
Species
D. melanogaster
Annotation Symbol
CG17367-PA
FlyBase ID
FBpp0084311
Associated gene
Length (aa)
723
Theoretical pI
6.63
Predicted MW (kDa)
77.0
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MGGNSTGANTSAFSAGGYIGPTSASSHHSLGTSSAAAAAAAGSDLIPAPIGTGNAMGVSSYAYGGTSWEEFCERHARVAA
SDFAKACITYINGNLPPEEARNIQHRSFAQKFVESFSAHYDTEFFKRRSTLKSGAGSLDFEEEHEVPKLLSKSLLRRLSF
KGLRKGKAFFHKNSDDLDGSGGSGKQSKTKLAKIVVECRKEGTVNNLTPESLDQPTGSQKWEKCRLVLVKAVGGYMLEFY
TPHKATKPRSGVFCFLISEARETTALEMPDRLNTFVLKADNNMEYVIEAESAEEMRSWLATIRYCMRTPPTQQPTIESDG
VMASAMQTSPTLPSPNPIGGIQNPQYQQQRGSNGNLVGGGAPLTSSLSADSALGQGGATSASELNVINELGTSPTSGPPD
IPVRPHRGEQRLSASSNFDGIEGTENDADVADLTAEMSVFPWFHGTLTRSEAARMVLHSDAAGHGYFLVRQSETRRGEFV
LTFNFQGRAKHLRLTISEKGQCRVQHLWFPSIQEMLEHFRHNPIPLESGGTSDVTLTEWVHSHSRLNDPTTAANHDSGQL
NDLSTNGNGNGNGNGYDNGQGSSTASNAAGGTASGAAGGGHPSPRHCNEVITMNLSVRLKTNEIELPQEPTHVYFPEQVY
FHLDPTTLTVHGSPPPAQNFLDQPHLRASNASLQAAAHHQAGSSGNRHPSDGGSNSGGAGGGSGSSGGAECTGRAVDNQY
SFT
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0084937
3113
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0084936
2918
FBtr0084935
3287
FBtr0339160
3128
FBtr0339161
3161
FBtr0339162
2951
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0084310
723
FBpp0084309
723
FBpp0308304
728
FBpp0308305
613
FBpp0308306
608
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG17367-PA
Name Synonyms
Secondary FlyBase IDs
    References (2)