Polypeptide Dmel\Ald-PE

General Information
Symbol	Dmel\Ald-PE	Species	D. melanogaster
Annotation Symbol	CG6058-PE	FlyBase ID	FBpp0084373
Associated gene	Dmel\Ald

Length (aa)	363	Theoretical pI	7.10
Predicted MW (kDa)	39.6

Map ( GBrowse )
Recent Updates
Description	What does this section display? This section contains items that were added to this record for each release. It currently only tracks new links between this FlyBase report and other FlyBase data classes (e.g. genes, references, stocks) or controlled vocabulary terms (e.g. GO, anatomy terms). What does this section not display? This section does not currently display links that were removed or gene model changes.
Update Feed	Click the icon below to subscribe to this FlyBase record and receive updates automatically through your feed reader.
FB2013_03
FB2013_02
All updates	Click here to see a list of all updates to this record from FB2010_08 and on.
Sequence
	MTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVE NTEDNRRAYRQLLFSTDPKLAENISGVILFHETLYQKADDGTPFAEILKK KGIILGIKVDKGVVPLFGSEDEVTTQGLDDLAARCAQYKKDGCDFAKWRC VLKIGKNTPSYQSILENANVLARYASICQSQRIVPIVEPEVLPDGDHDLD RAQKVTETVLAAVYKALSDHHVYLEGTLLKPNMVTAGQSAKKNTPEEIAL ATVQALRRTVPAAVTGVTFLSGGQSEEEATVNLSAINNVPLIRPWALTFS YGRALQASVLRAWAGKKENIAAGQNELLKRAKANGEAACGNYTAGSVKGF AGKDTLHVDDHRY
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide	Name FlyBase ID Length (nt) Ald-RE FBtr0085000 1747
Corresponding to OTHER polypeptides	Name FlyBase ID Length (nt) Ald-RB FBtr0084994 2636 Ald-RC FBtr0084995 1279 Ald-RD FBtr0084999 1483 Ald-RH FBtr0085001 1618 Ald-RI FBtr0114544 1736 Ald-RJ FBtr0306657 1614 Ald-RK FBtr0310660 1472 Ald-RL FBtr0310661 1615 Ald-RM FBtr0339614 2102
Other Polypeptides
	Name FlyBase ID Length (aa) Ald-PB FBpp0084367 361 Ald-PC FBpp0084368 361 Ald-PD FBpp0084372 361 Ald-PH FBpp0089214 363 Ald-PI FBpp0113036 363 Ald-PJ FBpp0297612 363 Ald-PK FBpp0302780 361 Ald-PL FBpp0302781 363 Ald-PM FBpp0308680 361
External Crossreferences
	RefSeq - An integrated, non-redundant set of sequences • NP_524515 DDBJ / EMBL / GenBank • AAN14384
Synonyms
	Ald-PE CG6058-PE
References ( 2 )
FlyBase analysis	FlyBase Genome Annotators, 2004, Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. [FBrf0166453] FlyBase, 1996-, FlyBase inference based on genome sequence analysis. FlyBase inference based on genome sequence analysis. [FBrf0104946]