Open Close
General Information
Symbol
Dmel\CG5938-PA
Species
D. melanogaster
Annotation Symbol
CG5938-PA
FlyBase ID
FBpp0084531
Associated gene
Length (aa)
168
Theoretical pI
5.99
Predicted MW (kDa)
19.3
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MSFSDFDAIYEDEQLDELEHFQDQTVAPVQEPIIIRGAGNMTVFGLSNRFNAEFPCGLLSRVAPEEFKATVGRINGVLKK
SLPVNVKWLFCGCVCCCCTLGCSLWPVICLSKRTQLTLDKLFEWENNHLYHKLGLHWRLHKQQCDSNSMMEYVILIEFIP
KTPIYRPD
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0085161
1255
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0085159
1401
FBtr0085162
1531
FBtr0085160
1673
FBtr0334729
1615
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0084529
168
FBpp0084532
168
FBpp0084530
168
FBpp0306777
168
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CG5938-PA
Name Synonyms
Secondary FlyBase IDs
    References (2)