Open Close
General Information
Symbol
Dmel\CG7834-PB
Species
D. melanogaster
Annotation Symbol
CG7834-PB
FlyBase ID
FBpp0084902
Associated gene
Length (aa)
253
Theoretical pI
8.44
Predicted MW (kDa)
27.2
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MARVLVGVKRVIDYAVKVRVKPDKTGVVTQGVKHSMNPFDEIAVEEAVKLKEKKLAEEVIAVSVGPAQSQEVIRTALAMG
ADRGVHVEIPAAEYELLQPIHVSKILAKLALDEKADLVILGKQAIDDDANQTAQMTAAVLDWPQGTFCNKIEKTDAGLTI
TREIDGGLETIKTKTPAVLSADLRLNTPRYATLPNIMKAKKKPLKKVTAKDLGVDTSPRIEVISVEDPPVRQAGATVADV
DALVAKLKEGGHI
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0085536
1116
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0085535
1021
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0084901
253
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CG7834-PB
Name Synonyms
Secondary FlyBase IDs
    References (2)