Open Close
General Information
Symbol
Dmel\CDase-PE
Species
D. melanogaster
Annotation Symbol
CG1471-PE
FlyBase ID
FBpp0085011
Associated gene
Length (aa)
704
Theoretical pI
6.57
Predicted MW (kDa)
78.2
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MANSKMAFLAFLAVSFLCGLVSATYKVGVGRADITGPPVEINFMGYANIKQVGRGIHTRVFARAFVVEDEKGNRVAFVSA
DAGMMGYGLKREVIKRLQARYGNIYHNDNVAISGTHTHGAPGGFLMHLLYDISILGFVPQTFEVMAQGLYLCIKRATDNL
VDGRILLSKTTVLNVNINRSPSSYLRNPAEERAQYEHDTDKTLTQLRFVDLENNLLGAFNWYAVHATSMNNTNRLVTSDN
VGYAALLLEKEYNPNKMPGKGKFVGAFCSSNLGDVSPNIMGPKCSISGNECDLLTSRCPTGEGDCFASGPGKDMFESTQI
LGQRLADAALGLLNEQSQESTAREVTGDVRFIHQFVDMPNYNGSTYNPLSRKVDKIRGCQPAMGYSFAAGTTDGPGAFSF
EQGTTTDNPMWNFVRDFIAAPTQEDIKCHEPKPILLATGRATFPYEWQPKIVSDQLLKIGDVIIAAVPCEFTTMAGRRLR
NQIRAAASAVGGIDTEVIIAGLTNIYTSYTVTPEEYQAQRYEAASTIFGPHTHSIYMDVFERLTKAMMRNETVDAGPSPP
YMNDVMLSLNTGVLFDGHPINTDFGYVKSQPNKEYGINETVKVTYISGNPRNNLFTEKTYFTIERKINEDRWKVAYTDAS
WETKMVWHRTNTILGFSEMDIYWDISPQTLPGEYRIRHSGEYKYILGGKYPYEGLTHSFTVKED
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0085649
2875
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0085646
2639
FBtr0085645
2372
FBtr0085647
2744
FBtr0085648
2740
FBtr0331357
2336
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0085008
704
FBpp0085007
704
FBpp0085009
704
FBpp0085010
704
FBpp0303775
704
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/Swiss-Prot - Manually annotated and reviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CDase-PE
CG1471-PE
Name Synonyms
Secondary FlyBase IDs
    References (2)