Polypeptide Dmel\tmod-PB

General Information
Symbol	Dmel\tmod-PB	Species	D. melanogaster
Annotation Symbol	CG1539-PB	FlyBase ID	FBpp0085025
Associated gene	Dmel\tmod

Length (aa)	403	Theoretical pI	5.86
Predicted MW (kDa)	45.5

Map ( GBrowse )
Recent Updates
Description	What does this section display? This section contains items that were added to this record for each release. It currently only tracks new links between this FlyBase report and other FlyBase data classes (e.g. genes, references, stocks) or controlled vocabulary terms (e.g. GO, anatomy terms). What does this section not display? This section does not currently display links that were removed or gene model changes.
Update Feed	Click the icon below to subscribe to this FlyBase record and receive updates automatically through your feed reader.
FB2013_03
FB2013_02
All updates	Click here to see a list of all updates to this record from FB2010_08 and on.
Sequence
	MESALPVAEFQQIKLRPVPKVKRRAPQPPVSLRLKHKNTSATTKTTTLTT PAKLYGKDLSEYDDVDVESLLAQLSPEEITILAKEVDPDDNFLPPDQRNS YECTKEATGPLNRKQLIEHINKQAIETPDQPEFEPFVQGKVRGKKWVPPP RDARDIEAEEQIAIDMGEEYEHALNDATQEEIIDLAAILGFHSMMNQDQY HASLLNKGQPVGLGWDGITKSTQQKLFPMDPPNNTDVEESIKRVKDDDSK LIDLNLNNIKNISDEKLEQLFAALPQNEHLEVLSLTNVGLTDKTALLLAA AIEKSKTLRVLNVETNFISPPVIVKLVQALLKCHTIEEFRASNQRSAVLG NKIEMEITDLVEKNSSLLRLGLHLEFNDARHRVAAHLQRNIDRIRVKRLN QRK
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide	Name FlyBase ID Length (nt) tmod-RB FBtr0085663 2508
Corresponding to OTHER polypeptides	Name FlyBase ID Length (nt) tmod-RA FBtr0085662 2537 tmod-RC FBtr0085661 2716 tmod-RD FBtr0085659 2906 tmod-RE FBtr0085658 2685 tmod-RF FBtr0085660 2770 tmod-RG FBtr0113483 3192 tmod-RH FBtr0302110 2717 tmod-RI FBtr0302111 3000 tmod-RJ FBtr0302112 2753 tmod-RK FBtr0302600 3232 tmod-RL FBtr0302601 2662 tmod-RM FBtr0306685 2299 tmod-RN FBtr0306686 2699 tmod-RO FBtr0306687 3484 tmod-RP FBtr0336446 4701 tmod-RQ FBtr0336447 3182
Other Polypeptides
	Name FlyBase ID Length (aa) tmod-PA FBpp0085024 367 tmod-PC FBpp0085023 409 tmod-PD FBpp0085021 439 tmod-PE FBpp0085020 439 tmod-PF FBpp0085022 439 tmod-PG FBpp0112393 526 tmod-PH FBpp0291320 372 tmod-PI FBpp0291321 439 tmod-PJ FBpp0291322 409 tmod-PK FBpp0291756 424 tmod-PL FBpp0291757 439 tmod-PM FBpp0297624 449 tmod-PN FBpp0297625 567 tmod-PO FBpp0297626 424 tmod-PP FBpp0307552 438 tmod-PQ FBpp0307553 454
External Crossreferences
	RefSeq - An integrated, non-redundant set of sequences • NP_477032 DDBJ / EMBL / GenBank • AAF57067
Synonyms
	CG1539-PB tmod-PB
References ( 2 )
FlyBase analysis	FlyBase Genome Annotators, 2004, Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. [FBrf0166453] FlyBase, 1996-, FlyBase inference based on genome sequence analysis. FlyBase inference based on genome sequence analysis. [FBrf0104946]