Open Close
General Information
Symbol
Dmel\CG2225-PB
Species
D. melanogaster
Annotation Symbol
CG2225-PB
FlyBase ID
FBpp0085268
Associated gene
Length (aa)
1100
Theoretical pI
8.02
Predicted MW (kDa)
118.6
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MAAAHESPKARDSTNVETERTFQLEAGQSYDTMAESHRAFHSLELEAGAEVAVDAAVEADSKRQNDNQLQSLEPISLDDI
PEPIKVLDEIISEFEEAATKPVALNCNSGENQSEDDGYMSLSRKNMSKKDSEDVPQTPSTDTVPEGSFNEVDGTAENLTK
LSEVVHGQETTSPLIQTTLPKARGSSSTPAVSSNYSSLPCCGVRASNLGGVSAANSSSGLSAIRHPGSCNGGRNALGIDI
SAVHNAVLRGNLAKLPEPFVNEHPVTIYPGPSSKTAVGEGARCKRLLSSVEKHKEVCHMLNPLSSGSNSSSGEASPAASH
VNVAKSKAAARDDEYSEDSLEESTISTELTPVKQNGVAWEIHFRNSKKKSSGFKNTSASKTKSNNLDDSFMYNERSMLGK
GTFIIRRSTAKKPPRVTDVFCIPKPPRSSLAEGVGPETKVGAGAISNEFYTSDSEQSDATPLPPPLPPASPDINFVYKEC
EANVEHTRRGLEMVVAHRAILSLDIEAPEQLGYCKPVKSKTAMLTEKRLSAESMPDNTSSSEEFEEARLNGIGSYELYGY
NGNDQRASNATTPHTDLAPTLEEDEELSDLSYGCAPLMQIEHNISALLRGDLPIIGQPAERKGGGLTGAATTAAEQHAKR
VLEFRHGVHKSESAKEMLLSQMPSLGPLPPSPPNSNPDLFDYNAPLPPSPVEPRKQLELPVVPNAPPANRGTTVVEVHAT
ASGTAVHSSNSHTRRSRDNIASVRHFTDELPPPPAPSHQSASFLEGNGGPPTVPPHRVTGGHSANTMKSWSIDSQYRKKS
PKLFGHYSSGGSGITTPTGLGPIAPLPPPHFDGMAGGSGSYHRRYINYGTKRSLKQSPREEHRLQTSCSLPETPIFARGC
DIPRTPYRRQNEPLPVVSGSRTAPRSSTSNSINMGASILGIGGGNYGTAQICRQRSINHALASNEMLRMTGAPARGWYPK
QRGMRPVSTENIDRMASMRVWDNPTVMSGTGQSRKPLTLPPNLTPSFLNKSPREALRRVTSLLITKKKNSKDRKHKAYCD
QLMDDSNSKHVYEFESGSTTRKDTNRKDNGASGATTNNKPKKKGLFKSLWKRSKTVSLDQ
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0085914
5543
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0085915
5390
FBtr0085917
3912
FBtr0085918
5246
FBtr0100618
4707
FBtr0304885
5627
FBtr0332967
5213
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0085269
1111
FBpp0085271
710
FBpp0085272
1111
FBpp0100078
975
FBpp0293424
1111
FBpp0305183
1100
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CG2225-PB
Name Synonyms
Secondary FlyBase IDs
    References (2)