Open Close
General Information
Symbol
Dmel\Vha16-1-PD
Species
D. melanogaster
Annotation Symbol
CG3161-PD
FlyBase ID
FBpp0085486
Associated gene
Length (aa)
159
Theoretical pI
8.78
Predicted MW (kDa)
16.3
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MSSEVSSDNPIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAG
ALEEPSKYSLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVAIYLYTK
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0086153
2816
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0086150
2833
FBtr0086151
2798
FBtr0086152
2981
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0085483
159
FBpp0085484
159
FBpp0085485
159
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/Swiss-Prot - Manually annotated and reviewed records of protein sequence and functional information
Synonyms and Secondary IDs (3)
Reported As
Symbol Synonym
CG3161-PD
Vha16-1-PD
Vha16-PD
Name Synonyms
Secondary FlyBase IDs
    References (2)