Polypeptide Dmel\Spn42Da-PA

General Information
Symbol	Dmel\Spn42Da-PA	Species	D. melanogaster
Annotation Symbol	CG9453-PA	FlyBase ID	FBpp0085524
Associated gene	Dmel\Spn42Da

Length (aa)	392	Theoretical pI	5.94
Predicted MW (kDa)	44.1

Map ( GBrowse )
Recent Updates
Description	What does this section display? This section contains items that were added to this record for each release. It currently only tracks new links between this FlyBase report and other FlyBase data classes (e.g. genes, references, stocks) or controlled vocabulary terms (e.g. GO, anatomy terms). What does this section not display? This section does not currently display links that were removed or gene model changes.
Update Feed	Click the icon below to subscribe to this FlyBase record and receive updates automatically through your feed reader.
FB2013_03
FB2013_02
All updates	Click here to see a list of all updates to this record from FB2010_08 and on.
Sequence
	MADAAHQEFARRLALFSINVYGKLSGQKPGENIVFSPFSIQTCAAMARLG AENETATQLDQGLGLASSDPEQIAHSFHQVLAAYQDSQILRIANKIFVMD GYQLRQEFDQLLSKQFLSAAQSVDFSKNVQAAATINNWVEQRTNHLIKDL VPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDGERTVQVPM MSLKERFRYADLPALDAMALELPYKDSDLSMLIVLPNTKTGLPALEEKLR LTTLSQITQSLYETKVALKLPRFKAEFQVELSEVFQKLGMSRMFSDQAEF GKMLQSPEPLKVSAIIHKAFIEVNEEGTEAAAATGMAVRRKRAIMSPEEP IEFFADHPFTYVLVHQKDLPLFWGSVVRLEENTFASSEHDEL
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide	Name FlyBase ID Length (nt) Spn42Da-RA FBtr0086197 1505
Corresponding to OTHER polypeptides	Name FlyBase ID Length (nt) Spn42Da-RB FBtr0086196 1385 Spn42Da-RD FBtr0086198 1531 Spn42Da-RE FBtr0086199 1643 Spn42Da-RF FBtr0086200 1669 Spn42Da-RG FBtr0086201 1651 Spn42Da-RH FBtr0086202 1763 Spn42Da-RI FBtr0086203 1370 Spn42Da-RJ FBtr0086204 1490 Spn42Da-RK FBtr0086205 1789 Spn42Da-RL FBtr0300336 2155
Other Polypeptides
	Name FlyBase ID Length (aa) Spn42Da-PB FBpp0085523 424 Spn42Da-PD FBpp0089189 411 Spn42Da-PE FBpp0089190 411 Spn42Da-PF FBpp0089191 411 Spn42Da-PG FBpp0089192 379 Spn42Da-PH FBpp0089193 379 Spn42Da-PI FBpp0089207 406 Spn42Da-PJ FBpp0089208 374 Spn42Da-PK FBpp0089206 379 Spn42Da-PL FBpp0289565 379
External Crossreferences
	RefSeq - An integrated, non-redundant set of sequences • NP_724512 DDBJ / EMBL / GenBank • AAG22209
Synonyms
	CG9453-PA Spn4-PA Spn42Da-PA
References ( 2 )
FlyBase analysis	FlyBase Genome Annotators, 2004, Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. [FBrf0166453] FlyBase, 1996-, FlyBase inference based on genome sequence analysis. FlyBase inference based on genome sequence analysis. [FBrf0104946]