Open Close
General Information
Symbol
Dmel\RhoGEF2-PF
Species
D. melanogaster
Annotation Symbol
CG9635-PF
FlyBase ID
FBpp0086124
Associated gene
Length (aa)
2559
Theoretical pI
6.76
Predicted MW (kDa)
280.8
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MDDPSIKKRLLDLYTDEHEYDEVQEIPEESSIQPPETSTSHTSTNGSSHSGPGTATGPGATSAGPSAGAPQSPVIVVDSV
PELPAPKQKSVKNSKSKQKQKQLANKSKIPRSPSLASSLSSLASSLSGHRDRDKDRDKDRENQNAVPPQTPPLPPSYKQN
QMNGDSTAAAGGGVSAPATPTTANNNNASHNNGSIMGGGVQLNQSDNSNPVLQAPGERSSLNLTPLSRDLSGGHTQESTT
PATTPSTPSLALPKNFQYLTLTVRKDSNGYGMKVSGDNPVFVESVKPGGAAEIAGLVAGDMILRVNGHEVRLEKHPTVVG
LIKASTTVELAVKRSQKLTRPSSVSVVTPSTPILSGRDRTASITGPQPVDSIKRREMETYKIQTLQKMLEQEKLNLERLK
SDQNNPSYKLSEANIRKLREQLHQVGAEDAPTVKLQAAAGNKNTALLTPNQIQHLSASATHSNQQFHHLHHHHNLHNNNY
PPQQQPASTSPAFLSLLPRSLSSLSLGTRKNKTEKDLTTSSPFGLTTDFLQQQRMSHQAESMSQSMHQHTSTPTSQQFFH
PHQQQHRFKETGPTSKGKNKFLISRSLIEEDVPPPLPQRNPPRQLNLDLKNGNASPGGSHLVAPVSDLDRATSPQLNRSQ
QQQLPSSTDNSPSNAKSKRSKIKTKALSDPKMSTQMFLQMESASAAGAAGGSIEVDGGPPPLPPRLPGMMTEDMSRGSCQ
NLAQPNSVGTAFNYPLVSTTTAVQNDNLNIAFPLSQRPNIVQQLQQYQQQQQHQMSGGQATGALGQTPNLGKNKHRRVGS
SPDNMHPRHPDRITKTTSGSWEIVEKDGESSPPGTPPPPYLSSSHMTVLEDPNENNRGAAAAGPGVFIESHQFTPMAGAS
SPIPISLHSSHMHAAQSNDTQKEIISMEDENSDLDEPFIDENGPFNNLTRLLEAENVTFLAIFLNYVISNSDPAPLLFYL
ITELYKEGTSKDMRKWAYEIHSTFLVPRAPLSWYRQDESLAREVDNVLQLEYDKVEILRTVFLRSRKRAKDLISEQLREF
QQKRTAGLGTIYGPTDDKLAEAKTDKLREQIIDKYLMPNLHALIEDENGSPPEDVRKVALCSALSTVIYRIFNTRPPPSS
IVERVHHFVSRDKSFKSRIMGKNRKMNVRGHPLVLRQYYEVTHCNHCQTIIWGVSPQGYHCTDCKLNIHRQCSKVVDESC
PGPLPQAKRLAHNDKISKFMGKIRPRTSDVIGNEKRSRQDEELDVELTPDRGQASIVRQPSDRRPDANISIRSNGNTSCN
TSGLNTTDLQSSFHGSCANDSINPGGGAGCNMDLSTSVASTTPSTSGSVAAGLSAFAELNALDTVDKEARRERYSQHPKH
KSAPVSVNRSESYKERLSNKRNRNSRRKTSDPSLSSRPNDEQLDLGLSNATYVGSSNSSLSSAGGSESPSTSMEHFAAPG
AAGGVQVPPMGLNQNQHPHLLIQQHAQQYCQQDSFQAGLAGAAGSSAASNSSFWNAGHPLPVARWTLESEDEDDVNEADW
SSMVAAEVLAALTDAEKKRQEIINEIYQTERNHVRTLKLLDRLFFLPLYESGLLSQDHLLLLFPPALLSLREIHGAFEQS
LKQRRIEHNHVVNTIGDLLADMFDGQSGVVLCEFAAQFCARQQIALEALKEKRNKDEMLQKLLKKSESHKACRRLELKDL
LPTVLQRLTKYPLLFENLYKVTVRLLPENTTEAEAIQRAVESSKRILVEVNQAVKTAEDAHKLQNIQRKLDRSSYDKEEF
KKLDLTQHHLIHDGNLTIKKNPSVQLHGLLFENMIVLLTKQDDKYYLKNLHTPLSITNKPVSPIMSIDADTLIRQEAADK
NSFFLIKMKTSQMLELRAPSSSECKTWFKHFSDVAARQSKNRSKNASSNHDTSISDPALAAIPHSNTKESLELSTDTVQP
LAATATLTTTPLAPMLPIATVTPAPATNNSNVSSLTGVQLRNPQRDATASESDADYVNTPKPRSSQNEVNRTMSIRSTGE
PIQKYSANGTEANDVTLRHSQSTRESVRPGSTGEERNSTYGMVGGNSKRDSASIVCSNNSNNTRTLLMQSPLVDPTAIQV
SISPAHTAEPVLTPGEKLRRLDASIRNDLLEKQKIICDIFRLPVEHYDQIVDIAMMPEAPKDSADIALAAYDQIQTLTKM
LNEYMHVTPEQEVSAVSTAVCGHCHEKEKLRKKVAPSSSFSSSPPPLPPPNRQHAQAQAQIPPSRLMPKLQTLDLDEVAI
HEDDDGYCEIDELRLPAIPSKPHERPTTPLAPFNTEPKTSQSVIDASKRQSTDAVPEGLLEQEPLEGDKTETKGEDNEVK
TVPSDKLSESCNEERQCVEADITKEVADPTTSKNEAAASVDELPSQSREIKTAENASKSVADKKEDNEETIEEGVASTVD
SSTQTSPTESPKETDKLTGGSSSTCGPNRIQHASVLEPSVPCHALSSIVTILNEQISMLLPKINERDMERERLRKENQHL
RELLSALHDRQRVDEVKETPFDLKKLMHAEDVEFDDDIDAISNSSLTPTPTPIPTASPSASGQVETAEAMRITSTEDEE
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0086970
8486
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0086971
8475
FBtr0086969
7424
FBtr0305083
8480
FBtr0340124
8166
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0086125
2559
FBpp0086123
2205
FBpp0293620
2557
FBpp0309117
2456
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG9635-PF
RhoGEF2-PF
Name Synonyms
Secondary FlyBase IDs
    References (2)