Open Close
General Information
Symbol
Dmel\CG4945-PC
Species
D. melanogaster
Annotation Symbol
CG4945-PC
FlyBase ID
FBpp0086247
Associated gene
Length (aa)
577
Theoretical pI
7.70
Predicted MW (kDa)
65.1
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MSKKPRGNIHKIREFELEKIQLVDEFDIIQIVGEGWFGKILLVEHRGSQTEMVLKAVPKPYVTLRDFYREFHYGLHLGVH
RHIVTTYDVAFETAGFYVFTQEYAPLGDLTSNVTDSGVGEVYSKRVAKQLASAIDYMHSKDIVHRDIKLDNVLIYRSDFQ
RIKLCDFGESFPTGSTVERRNEWLPYSPPEVLEIKPEGSYKADPSHDVWQFGIVIFVCLTGCLPWQKAASDDPRYVRYLA
WQGGLMMMPLRRTPRLFKLLTSNAQRMFKRFFARISNRPKSLADVTKFLDDRWLAKTAQKEMAEYETDELCPSMYSFHSS
PDEKNKLLYTLADCGIETNVDRQQKKNRIKDWIESSIITEEDEEENEETNSASPSSSVSREPLPGHISSLRKPTSPAESA
KEINSTLKDATQKHFDPRTGALQQGPSEMGQVAMAYSKSASPASNYSTTASTLNNADSLMTLGSRQDLLASNLTMYTSME
TELNRLGEADPRLNQRTQSNNPLLTTFDVNTNPAAKNSIGVGTRGSSRSILKSSIATAAYPALGAFNHGQSHSLQQLNQH
LQTSTGLTPSKSSFFRR
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0087100
2622
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0087098
2146
FBtr0087099
2458
FBtr0340062
1993
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0086245
551
FBpp0086246
577
FBpp0309068
533
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CG4945-PC
Name Synonyms
Secondary FlyBase IDs
    References (2)