Open Close
General Information
Symbol
Dmel\scb-PA
Species
D. melanogaster
Annotation Symbol
CG8095-PA
FlyBase ID
FBpp0086502
Associated gene
Length (aa)
1115
Theoretical pI
5.50
Predicted MW (kDa)
124.3
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MVGQDRDFWALLVLGLWCLSSHCNAFNLSPLPNRQILDPQFATNVPKVRASYFGFTMSLRPNGIIVGAPRAQSTLESQRT
INETGAIYRCSLTNGVCSPYVLDSRGNVDAPYSEYTFDSERKDFQWLGGSMDGGTKDTDKLLVCAPRFYAPSSRDNHLHG
VCYWVNNTVASTPQHVTRISPLRLKSEQVKEEDNGNKASFFYIMGELGLSAHVADDNTKFLIGAPGINTWRGSVILYRQV
DPVDNPTASRRDTSKALRRTYRDVDSNDYTPEHYAPEIPTPGLWGQEEDSYFGYAVSSGFFDSSNPTKLLYVATAPQANK
QSGEAYIFDVRGKSIHKYHVFRGEQFGEYFGYSVLAEDLNGDGKTDVIVSAPQHALEDSHDNGAIYVFINKGFFNFERQI
LRSPVETMARFGTALSRLGDINHDGYNDVAVGAPFAGNGTVFIYLGSENGLRDQPSQRLDAPSQQPSKYGSHMFGHGLSR
GSDIDGNGFNDFAIGAPNAEAVYLYRAYPVVKVHATVKSESREIKPEQEKVKITACYRLSTTSTDKLVQEQELAIRIAMD
KQLKRVKFTQTQTNEISFKVNANFGEQCRDFETQVRYSEKDIFTPIDLEMHYELTKKVPDSEEFCETCAIVDPTEPKVST
QNIIFSTGCATDVCTADLQLRSKDVSPTYILGSADTLRLNYEITNIGETAYLPQFNVTSTSRLAFAQVPGNCKVVDAVMV
CDLNRGRPLAKGDTDSVTISFDVSQLSGQSLIIHAEVFSTGYEQNPTDNRQTNVIGLKEFTEIDASGGQTNSQIDLEHYS
NSAEIVNNYEIKSNGPSVIEQLTVSFYIPIAYKVAGSTAIIPIINVTSLKMQASYDSQLLSIDLYDQNNTMLVVDPVEVT
TTLSGGLERTVITQNRQSYDIHTSGHVHQTMEVLDTSMVATASMSRKRRDLKALTANREQYARISNVKAHDLLSDDFKGK
LPVNRTIVFNCRDPEMTICVRAEMRVHFRPEKSINLNMRYSVDLNEVNAILVDPWEYFVILTDLKLQKKGDPTSTSFSIN
RRIEPNIISKHQETGLPIWIIIVSVIGGLLLLSAISYLLYKFGFFNRTKKDELDRLVQQNPVEPEAENLNSGGNN
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0087370
4304
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0087369
4643
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0086501
1115
External Crossreferences and Linkouts ( 4 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG8095-PA
Name Synonyms
Secondary FlyBase IDs
    References (2)