Polypeptide Dmel\Dro-PA

General Information
Symbol	Dmel\Dro-PA	Species	D. melanogaster
Annotation Symbol	CG10816-PA	FlyBase ID	FBpp0086566
Associated gene	Dmel\Dro

Length (aa)	64	Theoretical pI	11.81
Predicted MW (kDa)	7.1

Map ( GBrowse )
Recent Updates
Description	What does this section display? This section contains items that were added to this record for each release. It currently only tracks new links between this FlyBase report and other FlyBase data classes (e.g. genes, references, stocks) or controlled vocabulary terms (e.g. GO, anatomy terms). What does this section not display? This section does not currently display links that were removed or gene model changes.
Update Feed	Click the icon below to subscribe to this FlyBase record and receive updates automatically through your feed reader.
FB2013_03
FB2013_02
All updates	Click here to see a list of all updates to this record from FB2010_08 and on.
Sequence
	MKFTIVFLLLACVFAMGVATPGKPRPYSPRPTSHPRPIRVRREALAIEDH LTQAAIRPPPILPA
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide	Name FlyBase ID Length (nt) Dro-RA FBtr0087436 355
Corresponding to OTHER polypeptides	Name FlyBase ID Length (nt) Dro-RB FBtr0309055 754
Other Polypeptides
	Name FlyBase ID Length (aa) Dro-PB FBpp0301076 64
External Crossreferences
	RefSeq - An integrated, non-redundant set of sequences • NP_523744 DDBJ / EMBL / GenBank • AAF58216
Synonyms
	CG10816-PA Dro-PA
References ( 2 )
FlyBase analysis	FlyBase Genome Annotators, 2004, Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. [FBrf0166453] FlyBase, 1996-, FlyBase inference based on genome sequence analysis. FlyBase inference based on genome sequence analysis. [FBrf0104946]