Open Close
General Information
Symbol
Dmel\ACC-PB
Species
D. melanogaster
Annotation Symbol
CG11198-PB
FlyBase ID
FBpp0087948
Associated gene
Length (aa)
2323
Theoretical pI
5.95
Predicted MW (kDa)
261.9
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MSETNESNDTAAQSAEGERPSFLVGDEIDERAAEAGEACDEFPLKMQNDVRQNGDISERRKRLRPSMSRGTGLGQDRHQD
RDFHIATTEEFVKRFGGTRVINKVLIANNGIAAVKCMRSIRRWAYEMFKNERAIRFVVMVTPEDLKANAEYIKMADHYVP
VPGGSNNNNYANVELIVDIALRTQVQAVWAGWGHASENPKLPELLHKEGLVFLGPPERAMWALGDKVASSIVAQTAEIPT
LPWSGSDLKAQYSGKKIKISSELFARGCVTNVEQGLAAVNKIGFPVMIKASEGGGGKGIRRVDTTEEFPGLFRQVQAEVP
GSPIFVMKLARGARHLEVQLLADQYGNAISLFGRDCSIQRRHQKIIEEAPAIVAQPEVFEDMEKAAVRLAKMVGYVSAGT
VEYLYDPEGRYFFLELNPRLQVEHPCTEMVADVNLPAAQLQIGMGIPLYRLKDIRLLYGESPWGSSVIDFENPPNKPRPS
GHVIAARITSENPDEGFKPSSGTVQELNFRSSKNVWGYFSVAASGGLHEFADSQFGHCFSWGENRQQARENLVIALKELS
IRGDFRTTVEYLITLLETNRFLDNSIDTAWLDALIAERVQSEKPDILLGVMCGSLHIADRQITESFSSFQTSLEKGQIQA
ANTLTNVVDVELINDGIRYKVQAAKSGANSYFLLMNSSFKEIEVHRLSDGGLLISLEGASYTTYMKEEVDRYRIVIGNQT
CVFEKENDPSLLRSPSAGKLINMIVEDGAHVSKGQAYAEIEVMKMVMTLTSQEAGTVTFVRRPGAVLDAGSLLGHLELDD
PSLVTKAQPFKGQFLQPENAPVPEKLNRVHNTYKSILENTLAGYCLPEPFNAQRLRDIIEKFMQSLRDPSLPLLELQEVI
ASISGRIPISVEKKIRKLMTLYERNITSVLAQFPSQQIASVIDSHAATLQKRADRDVFFLTTQSIVQLVQRYRNGIRGRM
KAAVHELLRQYYDVESQFQYGHYDKCVGLVREHNKDDMQTVVNTIFSHSQVAKKNLLVTLLIDHLWANEPGLTDELANTL
SELTSLNRAEHSRVALRSRQVLIAAHQPAYELRHNQMESIFLSAVDMYGHDFHPENLQRLILSETSIFDILHDFFYHSNR
AVCNAALEVYVRRAYTSYELTCLQHLELSGGLPLVHFQFLLPTAHPNRLFSRMSSPDGLDQAAAESLGNSFVRTGAIAAF
DSFEHFEMYSDEILDLLEDFVSPAMVNAKVLEAVEAADSISDSRHSTSINVSLSDPVTRANAAEEAKSTEPIHIVSVAVR
ETGELDDLQMAQIFGNYCQEHNEELFQRRIRRITFAALKKRQFPKFFTFRARDKFTEDRIYRHLEPASAFHLELNRMKTY
DLEALPTANQKMHLYLGKAKVSKGQEVTDYRFFIRSIIRHSDLITKEASFEYLQNEGERVLLEAMDELEVAFSHPHAKRT
DCNHIFLNFVPTVIMDPAKIEESVTKMIMRYGPRLWKLRVLQAELKMVIRQSPQSPTQAVRLCIANDSGYFLDISMYTEQ
TEPETGIIKFKAYGEKQGSLHGHPISTPYMTKDFLQQKRFQAQSNGTTYVYDVPDMFRQMTERHWREFSKARPTVDIRTP
DKILIECKELVLEGDNLVEMQRLPGENNCGMVAWRIVLATPEYPNGREIIVIANDLTYLIGSFGIKEDVLFAKASQLARQ
LKVPRIYISVNSGARIGLAEEVKAMFKIAWEDPEEPDKGFKYLYLSTEDYAQVANLNSVRAILIEDEGEQRYKITDIIGK
DDGLGVENLRYAGLIAGETSQAYEEIVTIAMVTCRTIGIGSYVVRLGQRVIQIDNSHIILTGYAALNKLLGRKVYASNNQ
LGGTQIMFNNGVTHKTEAIDLDGVYTILDWLSYIPAYIGCDLPIVLPNDRIERPVDFMPTKSPYDPRWMLGGRVNPVNAN
DWENGFFDRDSWSEIMASWAKTVVTGRARLGGVPVGVIAVETRTVEVEMPADPANLDSEAKTLQQAGQVWYPDSSYKTAQ
AIKDFGREELPLIVFANWRGFSGGMKDMYEQIVKFGAYIVDGLREYKKPVLIYLPPNAELRGGAWAVLDSLINPRYMETY
ADPEARGGVLEPEGIVEIKYKEKDLVKTIHRLDPTTIALKKELDEANASGDKVRAAQVDEKIKARIAVLMHVYHTVAVHF
ADLHDTPERMLEKECISEIVPWRDSRRWLYWRLRRLLLEDAYIKKILRAQDNLSVGQAKQMLRRWLVEEKGATEAYLWDK
NEEMVSWYEEQINAESIVSRNVNSVRRDAIISTISKMLEDCPDVALDAVVGLCQGLTPVNRGVVVRTLAQMQLNEETSNS
NQG
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0088872
7833
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0088871
8010
FBtr0113053
7950
FBtr0339123
7741
FBtr0339124
7860
FBtr0339125
7814
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0087947
2482
FBpp0111966
2323
FBpp0308268
2348
FBpp0308269
2323
FBpp0308270
2323
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
ACC-PB
CG11198-PB
Name Synonyms
Secondary FlyBase IDs
    References (2)