Open Close
General Information
Symbol
Dmel\CG1674-PD
Species
D. melanogaster
Annotation Symbol
CG1674-PD
FlyBase ID
FBpp0088188
Associated gene
Length (aa)
264
Theoretical pI
5.66
Predicted MW (kDa)
29.6
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MDSTLNIENVNDPTSIASDLSAENTKADLVSLNEPNVNDQTSSASDLTAENTKADHDSLNKPKDFNNQILNIISDIDINI
KAQEKITQLKEQELKLIQKQNDLANEIHKQQILAKQLSAQNQLKQNECQSGELDLHSQYQNERGGPTSTLYQEKNIASKE
SANVSKTVDLRKIFTPATDAAEILPKNRKLYASSAFYSPTLHPTVEDQVELARRISHSLSDISNQTSKGQSMYVNRKKRS
DKWVHEGGSQGNVFFQYFLLSVSY
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0089119
1457
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0089116
2557
FBtr0300796
2989
FBtr0300797
2899
FBtr0300798
3016
FBtr0300799
2131
FBtr0300800
2419
FBtr0308086
2917
FBtr0308087
3052
FBtr0333671
2893
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0088185
743
FBpp0290020
884
FBpp0290021
884
FBpp0290022
884
FBpp0290023
589
FBpp0290024
694
FBpp0300429
860
FBpp0300430
905
FBpp0305827
843
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CG1674-PD
Name Synonyms
Secondary FlyBase IDs
    References (2)