Open Close
General Information
Symbol
Dmel\for-PA
Species
D. melanogaster
Annotation Symbol
CG10033-PA
FlyBase ID
FBpp0088350
Associated gene
Length (aa)
1088
Theoretical pI
6.15
Predicted MW (kDa)
121.3
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MRFCFDRLCFATKRPAQNSNSNAPHSSTTVDAPPRPADVDVATVPVATPAPPPQQPVSNLFYADYQKLQPAIIDRDWERD
RDTDTDTRSEAKPPDIVEHIEPVEEQRQIHTQIQSPAEIQIQIPPTPPAPSIQIQIQQRYRRHSSAEDRNLNTRRNDSNI
TEALRKAASMQQEPNANYQFPTDLGLVSIVNNNNNTNTHPSGSNSGSNNNSNINNNLVGGIVTLPAAGGLIGLEHTASGL
RLIPAPPTHSDVLTHTLIYGTPPSGAQQLNQDPRSLLHQQELQLQQRYQQLQQLQAQTQGLYTSQGSPVLYHQPSPGSSQ
PVAIPGATCHSPTQLQPPNTLNLQQQMQSLRISGCTPSGTGGSATPSPVGLVDPNFIVSNYVAASPQEERFIQIIQAKEL
KIQEMQRALQFKDNEIAELKSHLDKFQSVFPFSRGSAAGCAGTGGASGSGAGGSGGSGPGTATGATRKSGQNFQRQRALG
ISAEPQSESSLLLEHVSFPKYDKDERSRELIKAAILDNDFMKNLDLTQIREIVDCMYPVKYPAKNLIIKEGDVGSIVYVM
EDGRVEVSREGKYLSTLSGAKVLGELAILYNCQRTATITAITECNLWAIERQCFQTIMMRTGLIRQAEYSDFLKSVPIFK
DLAEDTLIKISDVLEETHYQRGDYIVRQGARGDTFFIISKGKVRVTIKQQDTQEEKFIRMLGKGDFFGEKALQGDDLRTA
NIICESADGVSCLVIDRETFNQLISNLDEIKHRYDDEGAMERRKINEEFRDINLTDLRVIATLGVGGFGRVELVQTNGDS
SRSFALKQMKKSQIVETRQQQHIMSEKEIMGEANCQFIVKLFKTFKDKKYLYMLMESCLGGELWTILRDKGNFDDSTTRF
YTACVVEAFDYLHSRNIIYRDLKPENLLLNERGYVKLVDFGFAKKLQTGRKTWTFCGTPEYVAPEVILNRGHDISADYWS
LGVLMFELLTGTPPFTGSDPMRTYNIILKGIDAIEFPRNITRNASNLIKKLCRDNPAERLGYQRGGISEIQKHKWFDGFY
WWGLQNCTLEPPIKPAVKSVVDTTNFDDYPPDPEGPPPDDVTGWDKDF
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0089304
4595
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0089307
3778
FBtr0089308
4218
FBtr0089306
4338
FBtr0089309
3826
FBtr0089310
4316
FBtr0089312
4581
FBtr0100363
3886
FBtr0301399
3223
FBtr0446099
3436
FBtr0473363
3016
FBtr0473364
2737
FBtr0473365
2467
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0088353
894
FBpp0088354
894
FBpp0088352
934
FBpp0088924
894
FBpp0088922
1088
FBpp0088923
1088
FBpp0099769
934
FBpp0290613
894
FBpp0402801
742
FBpp0422967
568
FBpp0422968
568
FBpp0422969
471
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/Swiss-Prot - Manually annotated and reviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG10033-PA
Name Synonyms
Secondary FlyBase IDs
    References (1)