Polypeptide Dmel\lola-PM

General Information
Symbol	Dmel\lola-PM	Species	D. melanogaster
Annotation Symbol	CG12052-PM	FlyBase ID	FBpp0088396
Associated gene	Dmel\lola

Length (aa)	465	Theoretical pI	4.80
Predicted MW (kDa)	49.3

Map ( GBrowse )
Recent Updates
Description	What does this section display? This section contains items that were added to this record for each release. It currently only tracks new links between this FlyBase report and other FlyBase data classes (e.g. genes, references, stocks) or controlled vocabulary terms (e.g. GO, anatomy terms). What does this section not display? This section does not currently display links that were removed or gene model changes.
Update Feed	Click the icon below to subscribe to this FlyBase record and receive updates automatically through your feed reader.
FB2013_03
FB2013_02
All updates	Click here to see a list of all updates to this record from FB2010_08 and on.
Sequence
	MDDDQQFCLRWNNHQSTLISVFDTLLENETLVDCTLAAEGKFLKAHKVVL SACSPYFATLLQEQYDKHPIFILKDVKYQELRAMMDYMYRGEVNISQDQL AALLKAAESLQIKGLSDNRTGGGVAPKPESSGHHRGGKLSGAYTLEQTKR ARLATGGAMDTSGDVSGSREGSSSPSRRRRKVRRRSMENDAHDNSNSSVL QAAASNQSILQQTGAGLAVSALVTTQLSSGPAAGTSSQASSTQQQQPLTS TNVTKKTESAKLTSSTAAPASGASASAAVQQAHLHQQQAQTTSDAINTEN VQAQSQGGAQGVQGDDEDIDEGSAVGGPNSATGPNPASASASAVHAGVVV KQLASVVDKSSSNHKHKIKDNSVSSVGSEMVIEPKAEYDDDAHDENVEDL TLDEEDMTMEELDQTAGTSQGGEGSSQTYATWQHDRSQDELGLMAQDAQQ RDPQGECLLPLKSII
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide	Name FlyBase ID Length (nt) lola-RM FBtr0089362 2150
Corresponding to OTHER polypeptides	Name FlyBase ID Length (nt) lola-RA FBtr0089344 2902 lola-RAA FBtr0343132 4623 lola-RB FBtr0089343 2974 lola-RC FBtr0089345 3123 lola-RD FBtr0089349 3423 lola-RE FBtr0089342 3417 lola-RF FBtr0089348 2627 lola-RG FBtr0089347 4267 lola-RH FBtr0089346 2146 lola-RI FBtr0089350 4239 lola-RJ FBtr0089360 3703 lola-RK FBtr0089353 2055 lola-RL FBtr0089352 2823 lola-RO FBtr0089361 3234 lola-RP FBtr0089355 3875 lola-RQ FBtr0089356 2327 lola-RR FBtr0089357 4015 lola-RT FBtr0089359 2245 lola-RU FBtr0089351 2239 lola-RV FBtr0089363 2438 lola-RW FBtr0089364 3446 lola-RX FBtr0089365 2938 lola-RY FBtr0089366 2397 lola-RZ FBtr0100286 2707
Other Polypeptides
	Name FlyBase ID Length (aa) lola-PA FBpp0088378 706 lola-PAA FBpp0309831 970 lola-PB FBpp0088377 787 lola-PC FBpp0088379 787 lola-PD FBpp0088383 748 lola-PE FBpp0088376 748 lola-PF FBpp0088382 565 lola-PG FBpp0088381 891 lola-PH FBpp0088380 518 lola-PI FBpp0088384 970 lola-PJ FBpp0088394 757 lola-PK FBpp0088387 546 lola-PL FBpp0088386 608 lola-PO FBpp0088395 668 lola-PP FBpp0088389 963 lola-PQ FBpp0088390 603 lola-PR FBpp0088391 891 lola-PT FBpp0088393 575 lola-PU FBpp0088385 575 lola-PV FBpp0088949 549 lola-PW FBpp0088950 771 lola-PX FBpp0088951 602 lola-PY FBpp0088948 577 lola-PZ FBpp0099680 665
External Crossreferences
	RefSeq - An integrated, non-redundant set of sequences • NP_788320 DDBJ / EMBL / GenBank • AAO41431
Synonyms
	CG12052-PM lola-PM
References ( 3 )
FlyBase analysis	FlyBase Genome Annotators, 2005, Changes affecting gene model number or type in release 4.2 of the annotated D.melanogaster genome. Changes affecting gene model number or type in release 4.2 of the annotated D.melanogaster genome. [FBrf0182792] FlyBase Genome Annotators, 2004, Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. [FBrf0166453] FlyBase, 1996-, FlyBase inference based on genome sequence analysis. FlyBase inference based on genome sequence analysis. [FBrf0104946]