Open Close
General Information
Symbol
Dmel\Atpα-PA
Species
D. melanogaster
Annotation Symbol
CG5670-PA
FlyBase ID
FBpp0088502
Associated gene
Length (aa)
1041
Theoretical pI
5.40
Predicted MW (kDa)
115.6
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MALRSDYEHGRADSYRVATVIATDDDNRTADGQYKSRRKMPAKVNKKENLDDLKQELDIDFHKISPEELYQRFQTHPENG
LSHAKAKENLERDGPNALTPPKQTPEWVKFCKNLFGGFAMLLWIGAILCFVAYSIQASTSEEPADDNLYLGIVLSAVVIV
TGIFSYYQESKSSKIMESFKNMVPQFATVIREGEKLTLRAEDLVLGDVVEVKFGDRIPADIRIIEARNFKVDNSSLTGES
EPQSRGAEFTHENPLETKNLAFFSTNAVEGTAKGVVISCGDHTVMGRIAGLASGLDTGETPIAKEIHHFIHLITGVAVFL
GVTFFVIAFILGYHWLDAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLT
QNRMTVAHMWFDNQIIEADTTEDQSGVQYDRTSPGFKALSRIATLCNRAEFKGGQDGVPILKKEVSGDASEAALLKCMEL
ALGDVMNIRKRNKKIAEVPFNSTNKYQVSIHETEDTNDPRYLLVMKGAPERILERCSTIFINGKEKVLDEEMKEAFNNAY
MELGGLGERVLGFCDFMLPSDKYPNGFKFNTDDINFPIDNLRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVIMVTGDHPI
TAKAIAKSVGIISEGNETVEDIAQRLNIPVSEVNPREAKAAVVHGAELRDVSSDQLDEILRYHTEIVFARTSPQQKLIIV
EGCQRMGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTS
NIPEISPFLAFILCDIPLPLGTVTILCIDLGTDMVPAISLAYEHAEADIMKRPPRDPFNDKLVNSRLISMAYGQIGMIQA
AAGFFVYFVIMAENGFLPKKLFGIRKMWDSKAVNDLTDSYGQEWTYRDRKTLEYTCHTAFFISIVVVQWADLIICKTRRN
SIFQQGMRNWALNFGLVFETVLAAFLSYCPGMEKGLRMYPLKLVWWFPAIPFALAIFIYDETRRFYLRRNPGGWLEQETY
Y
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0089510
3558
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0089511
3861
FBtr0089509
4524
FBtr0089512
5099
FBtr0089513
5033
FBtr0089514
4524
FBtr0089515
4524
FBtr0089516
4808
FBtr0300191
4524
FBtr0333324
5545
FBtr0333325
3721
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0088503
1002
FBpp0088501
1002
FBpp0088504
839
FBpp0088984
1002
FBpp0088983
1002
FBpp0088982
1002
FBpp0088981
1002
FBpp0289428
1002
FBpp0305516
1002
FBpp0305517
1002
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/Swiss-Prot - Manually annotated and reviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
Atpα-PA
CG5670-PA
Name Synonyms
Secondary FlyBase IDs
    References (1)