Open Close
General Information
Symbol
Dmel\Caper-PA
Species
D. melanogaster
Annotation Symbol
CG11266-PA
FlyBase ID
FBpp0088583
Associated gene
Length (aa)
594
Theoretical pI
10.63
Predicted MW (kDa)
66.5
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MAEDFDVEAMLEAPYMKNNVSAGSGGSGGRKRSGSSPGGGGGHDDDYAENGPRNGSGGGSSHKKQSKRSRSRSGSRDGKS
RRDRGNERSSHRDKDKERDRNRDGGDRDRHRREGGDRDRERERERERDRSRRSRSRDERGGGGRYGDRDKDRRSRDRRGG
SKSLQVDRSRDKRRRSRSRDQQRKRLSPIRERKRSHSRSRDRNSRRRGTNSPRRRSPPNGADRTTPTELSPEERDARTVF
CIQLSQRVRARDLEEFFSSVGKVRDVRLITCNKTKRFKGIAYIEFDDPESVALALGLSGQRLLGVPIMVQHTQAEKNRLQ
NAAPAFQPKSHTGPMRLYVGSLHFNITEDMLRGIFEPFGKIDAIQLIMDTETGRSKGYGFITYHNADDAKKALEQLNGFE
LAGRLMKVGNVTERLDMNTTSLDTDEMDRTGIDLGATGRLQLMFKLAEGAGLAVPQAAANALLATAPQPAPLQQQEVAPS
IATQCFILSNMFDPRTETNPTWDVEIRDDVLEECAKHGGVLHIHVDTISHTGTVYVKCPSTTTAVLAVNALHGRWFAGRV
ITAAYVPVINYHTMFPDSINAVDLVTSTRKNTDD
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0089640
2128
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0089636
2457
FBtr0344708
2623
FBtr0344709
2561
FBtr0344710
2453
FBtr0344711
3145
FBtr0344712
2484
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0088579
594
FBpp0311041
21
FBpp0311042
21
FBpp0311043
22
FBpp0311044
22
FBpp0311045
22
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG11266-PA
Caper-PA
Name Synonyms
Secondary FlyBase IDs
    References (2)