Open Close
General Information
Symbol
Dmel\larp-PA
Species
D. melanogaster
Annotation Symbol
CG42551-PA
FlyBase ID
FBpp0088622
Associated gene
Length (aa)
965
Theoretical pI
9.12
Predicted MW (kDa)
106.2
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MGTHYFGNVPAAYIELDANSIKEAIKKQVEYYFSVDNLTGDFFLRRKMDPEGYIPVTLIASFHRVLALTTDVAVIVNAIK
ESDKLELFEGYKVRTKTTPTTWPITEVPEVNEGEPKAIGTLEQEQLEQNDGQEKLEEQTEADSPPPILTSAMATKPLNSI
PPPPMPRNPQNLVPKMLQDKQQSRSSTIAALNSVNAISALTQQVEGGAAELAGHLSGLAESVKPKSTSTPDKRNAASAGN
GAGSAAALVAEPEGIWKEVKRRSKTNAIKENATTPPQQQQPPLSQTLNNNNDNVKTNNTSSKSKSSSNNAPSNASSSATV
CVTTNNASSATKATTKTTTTSTATTTTNNNIKSGNAAYSKTHSKSSSKTAAPPSAQCHAEKEELDFQFDEELMDPLPPGT
GRINNFTENFSDDDESDYEFADRDINKLLIVAQVGRAPKHEGYDRTADFTSRTKITQDLENIINDGLVNYEEDLWTTTNV
VADYKTVNVISQADFEKLAGGRNKSVLPPQVVPPPPPFEEDLDETLVGDTTLNSTLNNTLKSRRARFYAAPNSHSIDPRT
PRKRKLRHTANPPVEAHVGWLLDTVEHRPRTTSMGSSAGTSPTASSYGSFGSSVPQSLPVFQHPSHALLKENNFTQQAYH
KYHSRCLKERRRLGYGQSQEMNTLYRFWSFFLRENFNKSMYNEFRSLALEDAGNGFRYGLECLFRFFSYGLEKKFRPNIY
QDFQDETIADYETGQLYGLEKFWAFLKYYKNGEKLEVQPKLAEYLKSFKNIEDFRVVEPEINEMLQGVGSLNPGRQLNRH
RSVSESDGTAVIAAGGRRLNTTITNRSDYVGRLLQQQHQQQQQQQHHQYQQGYGGYNQQQNRRRTGSFGSTTVRIRSGSL
GNKPQVANRNQGSQHELRRGGSNSGLAPHKRQQQQKPKPGAGSQTGSTRATTSAAATATTAASAATSTAATPAVTVSSGS
SSSKK
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0089680
6745
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0089682
6757
FBtr0301180
8064
FBtr0301181
6820
FBtr0306388
7070
FBtr0306389
7915
FBtr0306390
7919
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0088624
965
FBpp0290398
1673
FBpp0290399
965
FBpp0297480
1409
FBpp0297481
1673
FBpp0297482
1673
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG14066-PA
Name Synonyms
Secondary FlyBase IDs
  • FBpp0290396
References (2)