Polypeptide Dmel\mod(r)-PC

General Information
Symbol	Dmel\mod(r)-PC	Species	D. melanogaster
Annotation Symbol	CG17828-PC	FlyBase ID	FBpp0088666
Associated gene	Dmel\mod(r)

Length (aa)	200	Theoretical pI	4.56
Predicted MW (kDa)	23.0

Map ( GBrowse )
Recent Updates
Description	What does this section display? This section contains items that were added to this record for each release. It currently only tracks new links between this FlyBase report and other FlyBase data classes (e.g. genes, references, stocks) or controlled vocabulary terms (e.g. GO, anatomy terms). What does this section not display? This section does not currently display links that were removed or gene model changes.
Update Feed	Click the icon below to subscribe to this FlyBase record and receive updates automatically through your feed reader.
FB2013_03
FB2013_02
All updates	Click here to see a list of all updates to this record from FB2010_08 and on.
Sequence
	MPTTPQDLALAHSLAQRPPTDSSEAKEQEAGESDNLPNLCTLSLDELKQL DRDPEFFEDFIEEMSVVQYLNEELDSMMDQVEIISRENECKGIHLVELKR RLSDDFTALKNLGEKCDRLNKKYFKKSDEYAPQHIRELLQIAASNADGDC DRHVEHFLNGKTDVQTFLNTYQWSKKISTERKAKEERLGTQLSALERAGI
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide	Name FlyBase ID Length (nt) mod(r)-RC FBtr0089725 1332
Corresponding to OTHER polypeptides	Name FlyBase ID Length (nt) mod(r)-RA FBtr0089726 1343 mod(r)-RB FBtr0089723 1099 mod(r)-RD FBtr0089724 1331 mod(r)-RE FBtr0335122 1323 mod(r)-RF FBtr0335123 1294
Other Polypeptides
	Name FlyBase ID Length (aa) mod(r)-PA FBpp0088667 200 mod(r)-PB FBpp0088664 196 mod(r)-PD FBpp0088665 196 mod(r)-PE FBpp0307122 196 mod(r)-PF FBpp0307123 200
External Crossreferences
	RefSeq - An integrated, non-redundant set of sequences • NP_726679 DDBJ / EMBL / GenBank • AAN09016
Synonyms
	CG17828-PC mod(r)-PC
References ( 2 )
FlyBase analysis	FlyBase Genome Annotators, 2004, Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. [FBrf0166453] FlyBase, 1996-, FlyBase inference based on genome sequence analysis. FlyBase inference based on genome sequence analysis. [FBrf0104946]