Open Close
General Information
Symbol
Dmel\CG33298-PB
Species
D. melanogaster
Annotation Symbol
CG33298-PB
FlyBase ID
FBpp0088794
Associated gene
Length (aa)
1517
Theoretical pI
9.10
Predicted MW (kDa)
168.6
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MPSANTEDLRRKFLVVQQQRSAPPNLTGDTLSSGIPNASASSATTSLMMTTSTGLGGVAMGAGEPERTYVFPGGNPVVGS
APGGGGQGIPGVAMAAPSRGHARSISHGGGAIVGANGRPIKSAMKGHQRAFSQGQITDSPPGSAAPAGRGHSRVGSKTDF
ILPPGHKEEPAREPSAPTSATGGRGHSRQASRSESIYTLRRTEAPPWWKRLTLCNYNTGDKFEERSYRTVVPNHTVPPKT
PKRDHPNGQFVGNKIRTTKYTLLSFIPKNLLEQFHRVANLYFIFIVLLNWVPEISAFGKEVAMIPVLFVLGVTAVKDLFE
DRRRRASDKRINNTTCRVYDGETERYKKVKWQELRVGDIVHLSNNETVPADILLLRTSDPQGVCYIDTCDLDGETNLKRR
EVVRGFEEMQSIFVPSKFVSRVEADAPTTKLYRFHGALIHPTGERVPISTECLLLRESRLKNTDYIEGIVVYAGHETKSM
LNNSGPRYKRSQVEQQMNIDVIWCVIILLILCVVGAIGCRMWLSSFTHFPVPYLPPNKLTANMESMWIFWTYIVILQVMI
PLSLYVTIELCKILQVFHIHNNVDLFDAETNKQTECRAMNITEELGQIQHIFTDKTGTLTENKMIFRRCVVNGSDYNHPP
SELEKIYSKPGAPAPPLIPNDNLNSDMAQLTQGTYLTPHAQRIQEFLVVLAICNTVIVGAAPHRDMMNASGIIEVQQIGN
SPANLKHGKQRQKLLASSTSTTTTTTIINGPTTQPQVVSIPADRYIRLAESRSVTPSPPPNLLFALPAQSHQPTLSPISS
SAESSPNSESESPSPPMKNKSLSNSISPTGRAKAVINSKITSIATFLNAKTQGKRMKLPSSKTGTIYRTADGRPLYEAES
PDELALVNAAYSYDCCLLNRSPNQILVSMPMAGATREYEILKVLPFDSSRKCMSIVVRQIGSQEIVLYTKGADSSIMPVL
VPCSHNSPEGILREQTQQLLDRYAREGLRILVMAKRTLNSADYTDWWARHQEIEMSLENRERRLRDSFAKLESNLTLLGA
TGIEDRLQDGVPETIASLLSAGISVWVLTGDKPETAINIAYSAKLFTQQMELIRLTARSRDAAETAINFYLTDMENDKTT
STLGYGQSLRKKQRALVVDGKTLTFILDPKSKLILPFLRLSKRCASVLCCRSTPLQKAYLVKVVKEELNLRTLAIGDGAN
DVSMIQMADVGVGISGQEGMQAVMAADFTLPRFRYLERLLLAHGYWCYDRLSRMILYFFYKNAAFVFLIFWYQLYCGFSG
QVMMDQMYLMLYNLIFTSLPPLAIGVYDKRVAEDLLLKNPYLYKNGRLGVAYRPHDFWLILLDALYQSLVIFFVALCAYA
ESDVGIWEFGTTITASCLFANLVHCAIEIRSWTVLHVLSIVLSLGSFYLFAIVYDSVCMNCFGVRSSYWVIFVCFASAVH
WLVIMLSTVVAVLPRLLLTTVRISLCPDDSTKVILQSKRERSRGEALLVTWSRSTSASSIYRITDYGSKNQIITTIT
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0089853
6463
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0089854
6408
FBtr0301064
5975
FBtr0301065
5920
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0088795
1494
FBpp0290286
1494
FBpp0290287
1494
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CG33298-PB
Name Synonyms
Secondary FlyBase IDs
    References (2)