Open Close
General Information
Symbol
Dmel\osa-PC
Species
D. melanogaster
Annotation Symbol
CG7467-PC
FlyBase ID
FBpp0088962
Associated gene
Length (aa)
2556
Theoretical pI
7.46
Predicted MW (kDa)
269.0
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MNEKIKSPQTQQQQQGGAPAPAATPPSAGAAPGAATPPTSGPPTPNNNSNNGSDPSIQQQQQNVAPHPYGAPPPPGSGPG
GPPGPDPAAVMHYHHLHQQQQQHPPPPHMQQQQHHGGPAPPPPGGAPEHAPGVKEEYTHLPPPHPHPAYGRYHADPNMDP
YRYGQPLPGGKPPQQQQPHPQQQPPQQPGPGGSPNRPPQQRYIPGQPPQGPTPTLNSLLQSSNPPPPPQHRYANTYDPQQ
AAASAAAAAAAQQQQAGGPPPPGHGPPPPQHQPSPYGGQQGGWAPPPRPYSPQLGPSQQYRTPPPTNTSRGQSPYPPAHG
QNSGSYPSSPQQQQQQQQQQQQQAGQQPGGPVPGGPPPGTGQQPPQQNTPPTSQYSPYPQRYPTPPGLPAGGSNHRTAYS
THQYPEPNRPWPGGSSPSPGSGHPLPPASPHHVPPLQQQPPPPPHVSAGGPPPSSSPGHAPSPSPQPSQASPSPHQELIG
QNSNDSSSGGAHSGMGSGPPGTPNPQQVMRPTPSPTGSSGSRSMSPAVAQNHPISRPASNQSSSGGPMQQPPVGAGGPPP
MPPHPGMPGGPPQQQQSQQQQASNSASSASNSPQQTPPPAPPPNQGMNNMATPPPPPQGAAGGGYPMPPHMHGGYKMGGP
GQSPGAQGYPPQQPQQYPPGNYPPRPQYPPGAYATGPPPPPTSQAGAGGANSMPSGAQAGGYPGRGMPNHTGQYPPYQWV
PPSPQQTVPGGAPGGAMVGNHVQGKGTPPPPVVGGPPPPQGSGSPRPLNYLKQHLQHKGGYGGSPTPPQGPQGYGNGPTG
MHPGMPMGPPHHMGPPHGPTNMGPPTSTPPQSQMLQGGQPQGQGASGGPESGGPEHISQDNGISSSGPTGAAGMHAVTSV
VTTGPDGTSMDEVSQQSTLSNASAASGEDPQCTTPKSRKNDPYSQSHLAPPSTSPHPVVMHPGGGPGEEYDMSSPPNWPR
PAGSPQVFNHVPVPQEPFRSTITTTKKSDSLCKLYEMDDNPDRRGWLDKLRAFMEERRTPITACPTISKQPLDLYRLYIY
VKERGGFVEVTKSKTWKDIAGLLGIGASSSAAYTLRKHYTKNLLTFECHFDRGDIDPLPIIQQVEAGSKKKTAKAASVPS
PGGGHLDAGTTNSTGSSNSQDSFPAPPGSAPNAAIDGYPGYPGGSPYPVASGPQPDYATAGQMQRPPSQNNPQTPHPGSP
YPSQPGAYGQYGSSDQYNATGPPGQPFGQGPGQYPPQNRNMYPPYGPEGEAPPTGANQYGPYGSRPYSQPPPGGPQPPTQ
TVAGGPPAGGAPGAPPSSAYPTGRPSQQDYYQPPPDQSPQPRRHPDFIKDSQPYPGYNARPQIYGAWQSGTQQYRPQYPS
SPAPQNWGGAPPRGAAPPPGAPHGPPIQQPAGVAQWDQHRYPPQQGPPPPPQQQQQPQQQQQQPPYQQVAGPPGQQPPQA
PPQWAQMNPGQTAQSGIAPPGSPLRPPSGPGQQNRMPGMPAQQQQSQQQGGVPQPPPQQASHGGVPSPGLPQVGPGGMVK
PPYAMPPPPSQGVGQQVGQGPPGGMMSQKPPPMPGQAMQQQPLQQQPPSHQHPHPHQHPQHQHPHQMPPNQTAPGGYGPP
GMPGGGAQLVKKELIFPHDSVESTTPVLYRRKRLMKADVCPVDPWRIFMAMRSGLLTECTWALDVLNVLLFDDSTVQFFG
ISNLPGLLTLLLEHFQKNLAEMFDERENEEQSALLAEDADDDADSGTVMCEKLRTSGRQPRCVRSISSYNRRRHYENMDR
SGKDGAGNGSDSEDADEGIDLGQVRVQPNPEERSLLLSFTPNYTMVTRKGVPVRIQPAENDIFVDERQKAWDIDTNRLYE
QLEPVGSDAWTYGFTEPDPLDGIIDVFKSEIVNIPFARYIRSDKKGRKRTELASSSRKPEIKTEENSTEEQTFNKKRRLV
SGGSSSSGAHAEGKKSKLTSEEFAQPNAEVKKEPGTADSDCRPVDMDIEAPQQRLTNGVAPCSSTPAIFDPRTTAKDEAR
VLQRRRDSSFEDECYTRDEASLHLVSESQDSLARRCIALSNIFRNLTFVPGNETVLAKSTRFLAVLGRLLLLNHEHLRRT
PKTRNYDREEDTDFSDSCSSLQGEREWWWDYLITIRENMLVAMANIAGHLELSRYDELIARPLIDGLLHWAVCPSAHGQD
PFPSCGPNSVLSPQRLALEALCKLCVTDANVDLVIATPPFSRLEKLCAVLTRHLCRNEDQVLREFSVNLLHYLAAADSAM
ARTVALQSPCISYLVAFIEQAEQTALGVANQHGINYLRENPDSMGTSLDMLRRAAGTLLHLAKHPDNRSLFMQQEQRLLG
LVMSHILDQQVALIISRVLYQVSRGTGPIHSVEFRLLQQRQQQQLRPGPAGKQAASAGGSATVKAETASTETSSTEAKPA
PAATTAVVNDENSNSSQQLPPAATFNDVSNSSTNSNSCGTASSNQTNNSTTNSSHSSSAISSQSAITVAAPSAAATGAGS
ATAAAIASDQQQVSKVAAAAAAAAALSNASAAAAAAAAAAAASVGPPTSSSVSAGAAVAQPAAPPPTNAGTTTAVA
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0089583
10234
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0089582
10675
FBtr0089581
10714
FBtr0301487
10423
FBtr0335024
9940
FBtr0335025
10243
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0088544
2703
FBpp0088543
2716
FBpp0290702
2716
FBpp0307030
2555
FBpp0307031
2559
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG7467-PC
Name Synonyms
Secondary FlyBase IDs
    References (2)