Open Close
General Information
Symbol
Dmel\svr-PG
Species
D. melanogaster
Annotation Symbol
CG4122-PG
FlyBase ID
FBpp0089126
Associated gene
Length (aa)
1439
Theoretical pI
6.31
Predicted MW (kDa)
162.7
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MPTLGLLFASIGIAVLAMGVPHCRGYTIKEDESFLQQPHYASQEQLEDLFAGLEKAYPNQAKVHFLGRSLEGRNLLALQI
SRNTRSRNLLTPPVKYIANMHGDETVGRQLLVYMAQYLLGNHERISDLGQLVNSTDIYLVPTMNPDGYALSQEGNCESLP
NYVGRGNAANIDLNRDFPDRLEQSHVHQLRAQSRQPETAALVNWIVSKPFVLSANFHGGAVVASYPYDNSLAHNECCEES
LTPDDRVFKQLAHTYSDNHPIMRKGNNCNDSFSGGITNGAHWYELSGGMQDFNYAFSNCFELTIELSCCKYPAASTLPQE
WQRNKASLLQLLRQAHIGIKGLVTDASGFPIADANVYVAGLEEKPMRTSKRGEYWRLLTPGLYSVHASAFGYQTSAPQQV
RVTNDNQEALRLDFKLAPVETNFDGNFRKVKVERSEPPQKLKKQFNGFLTPTKYEHHNFTAMESYLRAISSSYPSLTRLY
SIGKSVQGRDLWVLEIFATPGSHVPGVPEFKYVANMHGNEVVGKELLLILTKYMLERYGNDDRITKLVNGTRMHFLYSMN
PDGYEISIEGDRTGGVGRANAHGIDLNRNFPDQYGTDRFNKVTEPEVAAVMNWTLSLPFVLSANLHGGSLVANYPFDDNE
NDFNDPFMRLRNSSINGRKPNPTEDNALFKHLAGIYSNAHPTMYLGQPCELFQNEFFPDGITNGAQWYSVTGGMQDWNYV
RAGCLELTIEMGCDKFPKAAELSRYWEDHREPLLQFIEQVHCGIHGFVHSTIGTPIAGAVVRLDGANHSTYSQVFGDYWK
LALPGRHNLTVLGDNYAPLRMEVEVPDVHPFEMRMDITLMPDDPQHWASANDFRIIENVVNTRYHTNPQVRARLAELENQ
NGQIASFGYADSEFGTIFNYLKMTSDIGEPEEHKYKLLVVSSLYDTTAPLGREILLNLIRHLVEGFKLQDTSVVELLKRS
VIYFLPQTSKFQNVFDMYNSNTSICDPVLGDELAERILGPETDQAKDVFLQFLRSERFDLMLTFGAGNSDLNYPKGDSVL
VKFAHRMQRTEFNYSPLQCPPSATRQLHRETTERLTNMMYRIYNLPVYTLGISCCRMPHQKKIASVWRKNIDKIKNFLAL
VKTGVSGLVQNDKGQPLREAYVRLLEHDRIINVTKNVARFQLMLPHGLYGLEVTAPNYESQMIKVDVEDGRVTELGIIRM
HPFTLIRGVVLELPNNDNRATTSIAGVVLDESNHPVRNAKVSVVGQTQLRNFTGSMGQYRISAVPLGTITLKVEAPRHLE
ATRQMHLIQGGLATENVVFHLKVNEHVFGLPRFLFILCASVLIIVGVIVCVLCAQFWFYRRHRGDKPYYNFSLLPQRGKE
QFGLEDDDGGDDGETELFRSPIKRGMTIQPYFDEEQLERILHTDDDDDDGPHMEPELDVADDSEDDIVMLHNNGNKRRH
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0070087
5828
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0070081
5890
FBtr0070084
5904
FBtr0070085
3144
FBtr0070086
3130
FBtr0290016
5842
FBtr0290017
5267
FBtr0340146
3092
FBtr0344737
2851
FBtr0344738
5611
FBtr0344739
4986
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0070080
1406
FBpp0089123
1404
FBpp0089124
433
FBpp0089125
435
FBpp0288455
1437
FBpp0288456
1292
FBpp0309132
433
FBpp0311069
435
FBpp0311070
1406
FBpp0311071
1439
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG4122-PG
Name Synonyms
Secondary FlyBase IDs
    References (2)