Open Close
General Information
Symbol
Dmel\alien-PB
Species
D. melanogaster
Annotation Symbol
CG9556-PB
FlyBase ID
FBpp0089195
Associated gene
Length (aa)
444
Theoretical pI
5.28
Predicted MW (kDa)
51.5
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MSDNDDDFMCDDDEDYGLEYSEDSNSEPDVDLENQYYNSKALKEEEPKAALASFQKVLDLENGEKGEWGFKALKQMIKIN
FRLCNYDEMMVRYKQLLTYIKSAVTRNHSEKSINSILDYISTSKNMALLQNFYETTLDALRDAKNDRLWFKTNTKLGKLY
FDRSDFTKLQKILKQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTVQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRE
CGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVNSYQ
NNDINEFETILRQHRSNIMADQFIREHIEDLLRNIRTQVLIKLIRPYKNIAIPFIANALNIEPAEVESLLVSCILDDTIK
GRIDQVNQVLQLDKINSSASRYNALEKWSNQIQSLQFAVVQKMA
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0079781
2321
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0079780
1508
FBtr0339550
3172
FBtr0343095
1574
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0079381
444
FBpp0308633
444
FBpp0309805
444
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/Swiss-Prot - Manually annotated and reviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG9556-PB
alien-PB
Name Synonyms
Secondary FlyBase IDs
    References (1)