Open Close
General Information
Symbol
Dmel\Dyrk2-PB
Species
D. melanogaster
Annotation Symbol
CG4551-PB
FlyBase ID
FBpp0089218
Associated gene
Length (aa)
722
Theoretical pI
9.21
Predicted MW (kDa)
79.6
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MLDRCEMPIQLDNEKLRRDVRLSGSRLDLPQLCNGSRRLDGHNNHVAANENTVTTTSLNGNGNGNGNSNSNNNNNIGSPV
SSSTTNSSNGGNERGSSTKSNSSSGSGSSGNSASSTGSGELKCNTPMTPSELVKKFRNYLTDLEFEELKVYKEVWYFGQH
ASKNYNKPAPTANTTNLGYDDDNGNYKIIEHDHIAFRYEILEVIGKGSFGQVIRALDHKTNTHVAIKIIRNKKRFLNQAV
VELNILDELREKDADGSHNVIHMLDYTYFRKHLCITFELMSLNLYELIKKNNYNGFSMSLIRRFCNSIVKCLRLLYKENI
IHCDLKPENILLKQRGSSSIKVIDFGSSCYVDRKIYTYIQSRFYRSPEVILGLQYGTAIDMWSLGCILAELYTGFPLFPG
ENEVEQLACIMEVLGLPPKVLISVARRRRLFFDSRDAPRCITNTKGRKRSPGSKSLAHILHCQDRYFIDFLQRCLEWDPA
ERMTPDEAAHHEFLQPSASSRHRSCRMSSSSSSSGLNSVSQKSSCYSFSEISPGTNGPVVASITSTTAVHNAAIATTTKS
RQQPPSQSHGHAQSNGHLPDIKLSASDKYNSMQKVAVRSKITSSVSDLESVQQYSLHRIYGGVGSGSTHHVSSAATRKHL
PGTGSGIVGAMSSKYGSSTLAHNHHNVTHHNASTATIATTTHHHHHHGGQQQQQSSSGASTMAMSHSQSTGDVSDRAIFG
RA
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0089289
4677
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0089288
4037
FBtr0089290
4681
FBtr0100447
4417
FBtr0100448
4590
FBtr0329933
4663
FBtr0336949
2826
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0088344
722
FBpp0089219
722
FBpp0099869
722
FBpp0099870
722
FBpp0302965
746
FBpp0307879
757
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/Swiss-Prot - Manually annotated and reviewed records of protein sequence and functional information
Synonyms and Secondary IDs (3)
Reported As
Symbol Synonym
CG4551-PB
Dyrk2-PB
smi35A-PB
Name Synonyms
Secondary FlyBase IDs
    References (2)