Open Close
General Information
Symbol
Dmel\Antp-PK
Species
D. melanogaster
Annotation Symbol
CG1028-PK
FlyBase ID
FBpp0089247
Associated gene
Length (aa)
361
Theoretical pI
9.17
Predicted MW (kDa)
41.0
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MTMSTNNCESMTSYFTNSYMGADMHHGHYPGNGVTDLDAQQMHHYSQNANHQGNMPYPRFPPYDRMPYYNGQGMDQQQQH
QVYSRPDSPSSQVGGVMPQAQTNGQLGVPQQQQQQQQQPSQNQQQQQAQQAPQQLQQQLPQVTQQVTHPQQQQQQPVVYA
SCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHHMGHPQAQVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQG
PPQMHQGHPGQHTPPSQNPNSQSSGMPSPLYPWMRSQFERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLT
ERQIKIWFQNRRMKWKKENKTKGEPGSGGEGDEITPPNSPQ
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0081656
4851
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0081648
4890
FBtr0081650
4652
FBtr0081653
4863
FBtr0081649
4640
FBtr0081646
4111
FBtr0081654
3279
FBtr0081655
3490
FBtr0081652
4902
FBtr0081647
4691
FBtr0081651
4679
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0089241
374
FBpp0089243
365
FBpp0089244
365
FBpp0089242
361
FBpp0081160
297
FBpp0089245
378
FBpp0089246
378
FBpp0081162
378
FBpp0081161
378
FBpp0089086
374
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG1028-PK
Name Synonyms
Secondary FlyBase IDs
    References (2)