Open Close
General Information
Symbol
Dmel\Chc-PD
Species
D. melanogaster
Annotation Symbol
CG9012-PD
FlyBase ID
FBpp0089398
Associated gene
Length (aa)
1678
Theoretical pI
5.46
Predicted MW (kDa)
191.2
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MTQPLPIRFQEHLQLTNVGINANSFSFSTLTMESDKFICVREKVNDTAQVVIIDMNDATNPTRRPISADSAIMNPASKVI
ALKAQKTLQIFNIEMKSKMKAHTMNEDVVFWKWISLNTLALVTETSVFHWSMEGDSMPQKMFDRHSSLNGCQIINYRCNA
SQQWLLLVGISALPSRVAGAMQLYSVERKVSQAIEGHAASFATFKIDANKEPTTLFCFAVRTATGGKLHIIEVGAPPNGN
QPFAKKAVDVFFPPEAQNDFPVAMQVSAKYDTIYLITKYGYIHLYDMETATCIYMNRISADTIFVTAPHEASGGIIGVNR
KGQVLSVTVDEEQIIPYINTVLQNPDLALRMAVRNNLAGAEDLFVRKFNKLFTAGQYAEAAKVAALAPKAILRTPQTIQR
FQQVQTPAGSTTPPLLQYFGILLDQGKLNKFESLELCRPVLLQGKKQLCEKWLKEEKLECSEELGDLVKASDLTLALSIY
LRANVPNKVIQCFAETGQFQKIVLYAKKVNYTPDYVFLLRSVMRSNPEQGAGFASMLVAEEEPLADINQIVDIFMEHSMV
QQCTAFLLDALKHNRPAEGALQTRLLEMNLMSAPQVADAILGNAMFTHYDRAHIAQLCEKAGLLQRALEHYTDLYDIKRA
VVHTHMLNAEWLVSFFGTLSVEDSLECLKAMLTANLRQNLQICVQIATKYHEQLTNKALIDLFEGFKSYDGLFYFLSSIV
NFSQDPEVHFKYIQAACKTNQIKEVERICRESNCYNPERVKNFLKEAKLTDQLPLIIVCDRFDFVHDLVLYLYRNNLQKY
IEIYVQKVNPSRLPVVVGGLLDVDCSEDIIKNLILVVKGQFSTDELVEEVEKRNRLKLLLPWLESRVHEGCVEPATHNAL
AKIYIDSNNNPERYLKENQYYDSRVVGRYCEKRDPHLACVAYERGLCDRELIAVCNENSLFKSEARYLVGRRDAELWAEV
LSESNPYKRQLIDQVVQTALSETQDPDDISVTVKAFMTADLPNELIELLEKIILDSSVFSDHRNLQNLLILTAIKADRTR
VMDYINRLENYDAPDIANIAISNQLYEEAFAIFKKFDVNTSAIQVLIDQVNNLERANEFAERCNEPAVWSQLAKAQLQQG
LVKEAIDSYIKADDPSAYVDVVDVASKVESWDDLVRYLQMARKKARESYIESELIYAYARTGRLADLEEFISGPNHADIQ
KIGNRCFSDGMYDAAKLLYNNVSNFARLAITLVYLKEFQGAVDSARKANSTRTWKEVCFACVDAEEFRLAQMCGLHIVVH
ADELEDLINYYQNRGYFDELIALLESALGLERAHMGMFTELAILYSKFKPSKMREHLELFWSRVNIPKVLRAAESAHLWS
ELVFLYDKYEEYDNAVLAMMAHPTEAWREGHFKDIITKVANIELYYKAIEFYLDFKPLLLNDMLLVLAPRMDHTRAVSYF
SKTGYLPLVKPYLRSVQSLNNKAINEALNGLLIDEEDYQGLRNSIDGFDNFDNIALAQKLEKHELTEFRRIAAYLYKGNN
RWKQSVELCKKDKLYKDAMEYAAESCKQDIAEELLGWFLERDAYDCFAACLYQCYDLLRPDVILELAWKHKIVDFAMPYL
IQVLREYTTKVDKLELNEAQREKEDDSTEHKNIIQMEPQLMITAGPAMGIPPQYAQNYPPGAATVTAAGGRNMGYPYL
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0074182
5793
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0074179
5696
FBtr0074180
5653
FBtr0074181
5734
FBtr0112797
5683
FBtr0112798
5577
FBtr0339445
5788
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0073966
1678
FBpp0073967
1678
FBpp0089397
1678
FBpp0111709
1678
FBpp0111710
1678
FBpp0308531
1678
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/Swiss-Prot - Manually annotated and reviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG9012-PD
Name Synonyms
Secondary FlyBase IDs
    References (2)