Open Close
General Information
Symbol
Dmel\Pink1-PF
Species
D. melanogaster
Annotation Symbol
CG4523-PF
FlyBase ID
FBpp0099833
Associated gene
Length (aa)
721
Theoretical pI
8.18
Predicted MW (kDa)
80.2
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MSVRLLTVRLIKHGRYILRSYCKRDIHANILDQNQLKTRSKRGFPLPSTAANVLRTTPQQAAKSVVNVVPRTINSPSGSP
FNGSGSSPTSSSGIFRVGQHARKLFIDNILSRVTTTYSEDLRQRATRKLFFGDSAPFFALIGVSLASGSGVLSKEDELEG
VCWEIREAASRLQNAWNHDEISDTLDSKFTIDDLEIGPPIAKGCAAVVYAADFKKDVASDGASLHTDAQPQATPAFAPNS
WSTHEMMSPLQNMSRFVHNFGGSVDNVFHYSQPSAASDFVGAQSREQDQRHHEQQQHQNQEQEQHQNQEPSSSAFNVTSP
ANSNINSSVDSYPLALKMMFNYDIQSNALSILRAMYKETVPARQRGMNEAADEWERLLQNQTVHLPRHPNIVCMFGFFCD
EVRNFPDGHLLYPVAQPQRINPQGYGRNMSLYLLMKRYDHSLRGLLDSQDLSTRNRILLLAQMLEAVNHLSRHGVAHRDL
KSDNVLIELQDDAAPVLVLSDFGCCLADKVHGLRLPYVSHDVDKGGNAALMAPEIFNTMPGPFAVLNYGKADLWACGALA
YEIFGNRNPFYSSSGGMARERGEMTLSLRNSDYRQDQLPPMSDACPPLLQQLVYNILNPNPSKRVSPDIAANVVQLFLWA
PSNWLKAGGMPNSPEILQWLLSLTTKIMCEGRPQMGAGLMPVASCGNRRAYVEYLLICSFLARARLRRIRGALNWIQNVV
A
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0100416
3158
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0070956
2859
FBtr0070957
2779
FBtr0100413
2865
FBtr0100414
2773
FBtr0100415
2864
FBtr0100419
2921
FBtr0100420
2894
FBtr0345295
2411
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0070917
721
FBpp0070918
721
FBpp0099830
721
FBpp0099831
721
FBpp0099832
721
FBpp0099835
721
FBpp0099837
721
FBpp0311462
721
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG4523-PF
Pink1-PF
Name Synonyms
Secondary FlyBase IDs
    References (2)