Open Close
General Information
Symbol
Dmel\Eip63E-PG
Species
D. melanogaster
Annotation Symbol
CG10579-PG
FlyBase ID
FBpp0110221
Associated gene
Length (aa)
522
Theoretical pI
8.87
Predicted MW (kDa)
59.9
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MAELISQPTKINNNNFGAGVTMREKKGGALQKLKKRLSHSFGRLTISREDGDESTHHHHHHHHHRGGHGGHHNHGNKVPY
NGYNSEEYLDRLEPNGNIPADKTNCRYGAQESAKNDNNKPQDWRSTDSTDHHDRVQRQLSVSSDSKLLDEDIREEMKYHS
HVVMRPKKPPRPKSEVFLNKQETHPRRKRFSAFGGDSPFGKQEAYVKLEPLGEGSYATVYKGFSKLTYQRVALKEIRLQE
EEGAPFTAIREASLLKELKHSNIVTLHDIVHTRETLTFVFEYVNTDLSQYMEKHPGGLDHRNVRLFLFQLLRGLSYCHKR
RVLHRDVKPQNLLISDCGELKLADFGLARAKSVPSHTYSHEVVTLWYRPPDVLLGSTEYSTSLDMWGVGCIFVEMVTGMP
TFPGIRDTYDQLDKIFKLLGTPTEDTWPGVTHFPGYKPHKLGFYRPRKLGHNFPRLYDIIEGETIANGFLQLNPEQRLGA
DDALQHPYFAQLPKKLYELPDETSIFTVEGVQLYTEPNRQNK
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0110921
2958
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0073133
2700
FBtr0073134
2919
FBtr0073135
2891
FBtr0073131
3575
FBtr0073132
2981
FBtr0110920
3536
FBtr0110922
2625
FBtr0110923
2739
FBtr0110924
4769
FBtr0110925
2930
FBtr0301948
3311
FBtr0302598
4914
FBtr0330068
3575
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0072992
509
FBpp0072993
509
FBpp0072994
509
FBpp0072990
522
FBpp0072991
522
FBpp0110220
509
FBpp0110222
501
FBpp0110223
522
FBpp0110224
509
FBpp0110225
522
FBpp0291160
522
FBpp0291754
509
FBpp0303101
538
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
Eip63E-PG
Name Synonyms
Secondary FlyBase IDs
    References (0)