Open Close
General Information
Symbol
Dmel\Arp2-PB
Species
D. melanogaster
Annotation Symbol
CG9901-PB
FlyBase ID
FBpp0111781
Associated gene
Length (aa)
394
Theoretical pI
6.13
Predicted MW (kDa)
44.7
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MDSKGRNVIVCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRAVNKIGDIEVKDLMVGDEASQLRSLLEVSYPMENGVVR
NWDDMCHVWDYTFGPKKMDIDPTNTKILLTEPPMNPTKNREKMIEVMFEKYGFDSAYIAIQAVLTLYAQGLISGVVIDSG
DGVTHICPVYEEFALPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRIMKEKLCYIGYDIEMEQRLALETTVL
VESYTLPDGRVIKVGGERFEAPEALFQPHLINVEGPGIAELAFNTIQAADIDIRPELYKHIVLSGGSTMYPGLPSRLERE
IKQLYLERVLKNDTEKLAKFKIRIEDPPRRKDMVFIGGAVLAEVTKDRDGFWMSKQEYQEQGLKVLQKLQKISH
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0112868
2475
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0074295
2219
FBtr0310673
2217
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0074070
394
FBpp0302793
399
External Crossreferences and Linkouts ( 2 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
Arp14D-PB
Arp2-PB
Name Synonyms
Secondary FlyBase IDs
    References (0)