Open Close
General Information
Symbol
Dmel\tou-PE
Species
D. melanogaster
Annotation Symbol
CG10897-PE
FlyBase ID
FBpp0111979
Associated gene
Length (aa)
3131
Theoretical pI
6.56
Predicted MW (kDa)
336.6
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MNKNAGDGSDGKNSNKNSNAGGGGGAGGPHDPTGLLDAASLFAYWGRDPTGAAAAAASNPLFNSQFNAAAAAGLGLLPQA
GGASANDRYSMAAAAAAAAGAHHHQNTMAVAASQAASLAGLHPASWWSMAQLAAQDYFSRLQASGLSPFPHPDLAAAFGP
AGMGMGGGAGGAGAGGGGAGVLGQGGGGNGGSGNGGGGSSSGSSGSKSNKSRKEKRAAQQQQQQQQNLANSLNAAAAAAA
AAAANNPAAALASMHGFGVGVPGTSIPSVSTGSGSISTNSGGHGSYKSTASAYGKPSTMTSSSMANNPGSAYDPVTLHKE
LLAMQAVAAAASGSGSSGSSGKKSGGGGSSSSSMHSLGMGIGGSGGMMSSGKASTSVSASNSSLGGMHPSLTSSNPLMSP
HAGMGSSSSSSSKDRDKNNPSLNALNSLSQFGALGMTPQQSMQAAMNAFAASTGVSPSATVTSSPHHSSQQQQQMGGNSS
TSGSGKSSSKDYMMGTGSEHPSLLGVRLPPDTEIIKYTSSIVGPKIPGTTSRGRKKTISETEQQTTQQQQKQQHQAEQHL
LQQQQQAQKELDSTKNAISSLLAFPGLSPAKRARLEMEYAAMAAAAQQQHQQAQQQHQAQQQLHGMLGAAGIPGMAGLVG
LPGMSGNPLDQLSVSKASSSTAPTTSTSSSSAGSNLLNQSNSDRVEVIKLPPTITSNGAYNLSSKGKEVHDLTTDMATNS
GGVNLSLKSNAGSSALTPSGAVGSASNPITIDDFDAPLNLSMKPSDKSNSSSSNAAAGGSSSSSAALANLASDYQAASSG
QSGNSLQSLSSITAALGGTGGMPGGSISGSGGTSPAPAGAGSGATGGGSGSGGSGGGSSSYKEGRPRNLGRGVSKPKKNT
VASLLAQSRAVGLKPMLATQQLLQQGADIEKIRLALSEANAHMETSTDSESVAAESGLSESESEDANILNVAELRVPLEL
GWKRETVIRGLTKQGQIRGEVTYYAPGSTTPLKSNGQVFAILEQQPSNLSRENFSFSARAIVGSFLQPAPPPYANDGEYI
RMTDEDVAKRLEDLKVFTRQTLNVEQRIEIAKQQQAMRDAKKLQKEELARNKEKARQEKNSKLEQQRKDKELKNQQAVEE
RKKRQEELDRLKQEELLKKQQEKEKRRQEAILAKEQELQKQKEMLLAAEMERERRRQHMSLIRMLELRRKFEDREKKKHQ
LVLDRLLLRERRMAERKRDAEILQLIRRPNEDSEMPQELVIPELDRIAGNRLPGQAMADLLMVFEFLHNFGETLGFDMES
LPSLQNLHDALMSDSNADAEEELLSVMTHLLVCAIEDPGVPNPGRHTTLLGQSLRNADITNSNVSEILRIYLYATATGEV
RQMHGITVDRERERRVPDHHQLDSDTTTHSHSVKNQEYYKLLHENDTWKLSQSLKDRPFVALNPTRKAQMLAHLCNDLLM
NKAVLRQIDGSLETCAQMRKEKYMTDMKVRKYKALHMRKARIEAYERAQAEREAAMQALMAQQKLDAERLKAEEEAKAAA
AEEAAAAAGTDGEATKGGSPNGEKPEDGDQNEEGAAKEPQQQQQQPMEVDGVVDEASLVSPAKTIIQTDNSLTPSKQDMP
TPTYQINGSSTPTTSGVTGGDMNVLLQAKKSGARNSINDEHHHDVSIIDDDLSDLDSEITNVEEDEDNRLSADELQKKLD
KIVRASLNCKEALEKSTNQLRAACFGQDRFWRRYWKLPKAGGIFIEALESAQNDICDYHEALEAMDDKKDANDEKENSEN
EKDVAAESSEQPMEVDESITKLEDGVPASDVGMPESNQQNAHQDEEDDDDDVTEINKVEPEIVDLGDDDDDAAPPLPKIE
PPRPEIKVKSEMELMGPPPTTMISTKTDFEAEIKIPSMPGILMPPTLNNNNTNNNNNNNGSDNCDKLETGLGLGQQQQNF
SQSVIKTEDVKKEDDCIIVSTSSVDDTPKWFSIVRREVPLISELPAEEGGVVGQELQISYANQNCSAQLQLQGHPWDLIN
NMQYYSIPMDECKVDTSKLGNECIFSLSGLDEKQMLAKVEEYKAHKVESKNGLGSPHRHHETKDDEEQAKLKLDKEIDTE
METDADDLAGKEKFFRLRSDVPPDTGGGVSEGTDVKPKIELRLDEALSQAYYHNIANMSLSSVQTYIPIDIPLPLSMTPD
EHRLLEQVKLAGFPERVHGVYVPRRQRYGWWQLDDEQKLRQLLKTLNPSGLRERELQENLQRFLGLEQPLGVNYKLKSDI
DFPEEFLMPDKKGDWNPKVAKRVELALIEQLESLEDKVASASMQLKNWQLPNRVESELTLDSQEDVTEEDFVSIIPMIRE
RIIDLEANIERRYLKPPLGSQTGDAHLAVIAQNQHTTTQTQNSASAAAYLLQMQQQQQQQQLAQQQQQQQQGSGAGNSLN
PSSFNERTMALAAAAAASGPGNATGVANSAVVAGATPCESGSGEPNSGNASPASNCDSDRDEKVEQIPKGLVQWRDAVSR
SHTTAQLAMALYVLESCVAWDKSIMKAYATKNKSSKKKSSAKKQATPSKKQQQKKNKKEQQLTPNGKESKSKSAINKPEN
QAPLSIKINLKALAQNGQCLLKTKTPPILTKSPTASPSSHPNTSDSDSDFGKRTKKKSGGKRRRSANNTNSSKYSNSLQN
CQFCTSGENEDKLLLCDGCDKGYHTYCFKPKMDNIPDGDWYCYECVNKATNERKCIVCGGHRPSPVGKMIYCDLCPRAYH
ADCYIPPLLKVPRGKWYCHGCISRAPPPKKRSAGGTSGSSSKSRRDRDRESGGSAKRRSDNSKTPAMEHMQQQQMPLAGG
DSHHHHHQQPPSLNSSHDESMNSLPAAPLSPAHSVVSATNYDDQHHANNSVDGSSRFHAHLIPPSNNGTAALLEDVPGGA
NVMPGVYPVYTPVAAGNFSAGLINQAPVQPAMPFANVVAMSPRAVTPTRTRTPTPTPAPTPPPPPPTPLLMQASPTATAL
HVNACQSPPQQQHAQLMTMPSPPAIGVGTATNQMSPPPINIHAIQEAKEKLKQEKKEKHATKKLMKELAVCKTLLGEMEL
HEDSWPFLLPVNTKQFPTYRKIIKTPMDLSTIKKKLQDLSYKTREDFCVDVRQIFDNCEMFNEDDSPVGKAGHGMRKFFE
SRWGELTDKHS
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0113066
10866
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0088091
10470
FBtr0088094
2291
FBtr0333070
11743
FBtr0333071
10721
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0087193
2999
FBpp0087196
249
FBpp0305283
3058
FBpp0305284
3094
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
tou-PE
Name Synonyms
Secondary FlyBase IDs
    References (0)