Open Close
General Information
Symbol
Dmel\Sesn-PC
Species
D. melanogaster
Annotation Symbol
CG11299-PC
FlyBase ID
FBpp0112027
Associated gene
Length (aa)
497
Theoretical pI
5.10
Predicted MW (kDa)
55.9
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MYYAVDYYADMGQISQDCFAATQTGASDFDMDELDDLDQVTQVIGYHPQFHDHFLATQNFIMKGDGPLPNDYRYYLAIIA
AARHQCPYLVKRYEKEFINQGGDSAWLGGLDFIPAKLRAIYDINKILAHRPWLLRKEHIERLTKGKNSWSLSEVVHAMVL
LSHFHSLSSFVFSCGLTQKLDGLSSPKLKSPPAAVAALAPTILITPTSPTEPQKGKPVLAEISLNNANPDYDSQTAASSN
GGAPPDSANAVADGPDATTLNGYLATAQQLPQQHGISVETLMERMKVLSQKQDECSEAELSSRFQKVEQQTAELAAVTPE
AAVGVPTNLSHYVDDANFIYQDFARRGTESINTFRIQDYSWEDHGYSLVDGLYNDVGIFLDAKFRAAYNLTYCTMGGIKN
VDTSKFRRAIWNYIQCIYGIRHDDYDYGEVNQLLVRPLKMFIKTACCFPERITTKDYDSVLVELQDSEKVHVNLMIMEAR
NQAELLYALREIMRYMT
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0113114
4745
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0072087
3097
FBtr0113113
3053
FBtr0343268
2431
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0071996
497
FBpp0112026
497
FBpp0309933
467
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/Swiss-Prot - Manually annotated and reviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG11299-PC
Sesn-PC
Name Synonyms
Secondary FlyBase IDs
    References (0)