Open Close
General Information
Symbol
Dmel\CG11537-PD
Species
D. melanogaster
Annotation Symbol
CG11537-PD
FlyBase ID
FBpp0112045
Associated gene
Length (aa)
705
Theoretical pI
5.48
Predicted MW (kDa)
75.3
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MRSGRSYGQRQSDTLESSFELEDSEAEQVNSPVAIKGEPSAHGDTDRDGDADRERQESGEQTDSLSTRSSSSTPTTADVA
DVETISSLPLSPPAFGGRGNQLVKRHSPLKDKQAEQADSSSSSSCSQQPDADDVPTVSGCDLRQSPPSSSSSSSSTSTSP
QTSRYAAAAAHPSAAFAETAITASSGSGRVCGGSGGAAHRRTHSAASYISMRSQGGNSEATPERPKRNRFFEWIRVVCNI
CCCKSSGIGEPSVHHALVVIFLEFFAWGLLTMPIISTLNQTFPDHTFLMNGLVMGIKGILSFLSAPLIGALSDIWGRKFF
LLVTVFFTCLPIPLMSINTWWFFAMISISGAFAVTFSVVFAYVADVTTPEERSKAYGLASATFAASLVISPALGNALMEM
YGDTLVVALSTAIALLDVFFILVAVPESLSEKMRPASWGAPISWEQADPFLALRKVGTDKTVLMLCLTVLLSYLPEAGEY
SCMFVYLKLKMGFNYVEVSVFIAIVGILSITVQVTLGSFMQVFGAKRTIIMGLALEIVQLLWYGFGSQKWMMWSAGVVAA
LGSITYPAISAFVSLYAAPESQGAVQGMITGMRGLCNGLGPAVFGVVFYLFNVDLNDDHDSHAKSSGSRATNVEKISQHV
PGPPFVFGALCVFCAIIVSAFIPEGQTSTLEKKRASLDVQYEIEPGHKAPSSLAPLIRSDSLAQL
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0113132
3911
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0073117
2973
FBtr0073116
3839
FBtr0073115
2510
FBtr0113133
3214
FBtr0309235
2505
FBtr0333894
3348
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0072979
680
FBpp0072978
680
FBpp0072977
488
FBpp0112046
705
FBpp0301174
680
FBpp0306026
705
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CG11537-PD
Name Synonyms
Secondary FlyBase IDs
    References (0)