Open Close
General Information
Symbol
Dmel\ScsβA-PB
Species
D. melanogaster
Annotation Symbol
CG11963-PB
FlyBase ID
FBpp0112118
Associated gene
Length (aa)
502
Theoretical pI
9.05
Predicted MW (kDa)
54.8
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MASFLARTGGPLIETVRPAAIKKILGLAPIAVQQLRNLNVQEHVSYSLLNEAKIPTPRFAVAKNGKEANDIATKLKTDNL
VLKAQVLAGGRGKGTFKNGLKGGVRVVYDPQTAEELSSKMIDQLLVTKQTGAAGRICKKVMVAERKFPRREFYFAVMMER
AFNGPVLIASKEGGVDIEEVAASSPDAILYEPIDIGTGLTSEQAEKIVKKVGLGGDGEDTHVQMLLNLYDLFVKKDALLV
EINPYAEDAMSGFFALDAKLRFDDNAEFRQKELFALRDWTQEDPKEVEAAKYNLNYIALDGTIGCMVNGAGLAMATMDII
KLYGGEPANFLDVGGGATAEAVKAAFKIITSDPKVLCILVNIFGGIMRCDVIAEGIISATKDLNLNMPVVVRLQGTKVKE
ARELIRTSGLKILARDDLDKAADLAVHLAQIVKLAREMKMDVNFEIPDAQKGKGDCKKDQKQPDSKGGKKSEKKDDKKSD
CTKKEEKKKEEKKDICEKKGKK
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0113206
1764
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0081957
1736
FBtr0301786
1767
FBtr0301787
1739
FBtr0334327
1901
FBtr0334328
1873
FBtr0347567
1876
FBtr0347568
1904
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0081437
502
FBpp0291000
503
FBpp0291001
503
FBpp0306436
451
FBpp0306437
451
FBpp0312599
452
FBpp0312600
452
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (3)
Reported As
Symbol Synonym
CG11963-PB
ScsβA-PB
skap-PB
Name Synonyms
Secondary FlyBase IDs
    References (0)