Open Close
General Information
Symbol
Dmel\CG8176-PC
Species
D. melanogaster
Annotation Symbol
CG8176-PC
FlyBase ID
FBpp0112119
Associated gene
Length (aa)
1220
Theoretical pI
8.55
Predicted MW (kDa)
129.9
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MTVDFNDYFWGEKNNGYDVLYHNMKFGLIASKELSEFLREKSNIEEQNSKMMSKLAHKAGTLNSTFAPVWTILRTSAEKL
STLHLQMVQKLTELVKDVAKYADELHKKHKSVKEEESQTLECVQAIQTSTVAVQKLRDLYASKVQELEKLRKDNGSHKDA
EKLESKLKKLQEEYKALLDKHNPIKNEFERRMTQTCKRFQEIEEVHLRQMKEFLSTYLEMLQNNHDMVGQVHSDFKRQFV
DMSVDKLLEQFVLNKYTGLEKPEMPELEYVALSSGSRLQQPQVSASASNSNSATSIQAALRAGNAATTASGSAVSMDQRG
DALAAISLGSGSAASGSIPFAEDPILGAMGSPRPTSPDMLAGANASGIQSQPTGGATSTVKSLRSWFLPTAKQQPSAGAG
NFGMAGSGSTNNTTTTTTASNNSNNLNTNNTTATTTTTTGTNNLTTNITKNSPNSEDTSNQDQTQQQPAEALTPTASATA
IAAASAPGKKQLNATTSEQQLSKSLNEQEHLQQTAAATAATTAAATTATTTTSRRATSLLNIFTSNSQVSGILRSRRDKT
KTKKAKKKKDNEAAENIQEERLTSLDRGNNTLLDYDDHGRSMKTQNSSGSSAGGGLAALSVTSAQGSVDSAGASSMGGSG
GAAVASGSLPNAGALTNSASITAPGAASGTGTGYEVDEEGFSIQPAKEIAWEEGQDKSGSFYSDSDTDSDNDKQERRIHV
SIKPLKNGQAPMSASVDELRATVENISLSPTGVFSHHSQQLQAARGAPASRQQSPEISNASTPTASVHPYAPLQSPTLSN
NNNANNTTNSRYADLGDIFSELGDMSMSAPSSATLGKPPGRQIPTPTSASTGGSIAIPRPPSRRSDMIAIGPAATGTAPG
RGRMSPAPVTAMNRAESIGSLEFRTAIGGVGSSRGPSPLTIGISDTIPLAVAFHEIIHAYFRGSDESRCQVKVSGDMMLS
FPAGIAGLLANNPNPAKLGFRIKHVQNLENLVPNGKLVQIDRQQSSSVSTMLEFNMGALTALLRRQAENNPTASYFNVDI
LKYQVRTKPGASSCPFQLVSYWKCESSYTALKVDYKYNNHAMASASPLLNVTLSVPVNGSVRNVQSKPHSAWLGESNRLV
WNFTDISQNSQDGGVGTLRARLELNDGPSTPALLATQFNCEGTTLSGIEFELQGSGYRLSLVKRRFVSGKYVCEGDGIRS
GATPTPPSVGSTSPYSAKSN
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0113207
4955
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0082065
4651
FBtr0334650
4465
FBtr0334651
4726
FBtr0334652
4549
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0081543
1133
FBpp0306712
1133
FBpp0306713
1220
FBpp0306714
1161
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CG8176-PC
Name Synonyms
Secondary FlyBase IDs
    References (0)