Open Close
General Information
Symbol
Dmel\anne-PH
Species
D. melanogaster
Annotation Symbol
CG32000-PH
FlyBase ID
FBpp0112329
Associated gene
Length (aa)
1451
Theoretical pI
6.79
Predicted MW (kDa)
164.2
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MFASQSKACDSPSETVHLQSLPNHIEDLKFRNSDVETDDDLHFPGIAAKNKILKLSWWHSPVDMHYVATESVQPKKSDKV
PSNKIKKVENNNTLVNGCSKTSARSVPLLKYNRPDQDGDSEENITSVLEPNVDEIYSKDSERLVDDSKPCIGLLNPDQED
QMKVCGYRRSLMRTGFCWACIFLTGGLLRLVLHWWRHLYLYATCSQCSLEEAEQVLVTEDYQGKHKMYHVKQIQVLTSSN
LKTLLEKEQQSIERTHIECDHVENVLQLSVHFTSAQFKKCSSIRIFRCKQLVYAWNNNTNRFQRINGLDLNIPCSYYHQQ
RGLPVHEQISRRIVFGDNEITVPLRDFKTLLFLEVLNPFYVFQLFSVILWFTYDYYYYACVILLMSVFGITVSVLQTKKN
QDVLQKTVYNTGNAWVVDHKGLSKELPTRAIVPGDIIEIPSSGCTLHCDAILISGNCILDESMLTGESVPVTKTPLPSKR
DMIFDKTEHARHTLFCGTKVIQTRYIGSKKVLAFVINTGNITAKGELIRSILYPPPVDYKFEQDSYKFIQFLAIIACVGF
IYTLVTKILRGTDPVKIAVESLDLITIVVPPALPAAMTVGRFYAQKRLKTSEIFCISPRSINVAGSINCCCFDKTGTLTE
DGLDMWGVVPKSSTNQFQIPLKSVDRLPFDHFLFGMVTCHSITILNGRMMGDPLDLKMFESTGWELEDSNNIPDTEKYGI
LYPTILRQPRGGLSGMAETESGSKNEIKRQSSVDDLLATVGISPSQKNFDHGIVREFPFTSALQRMSVVTRCLSDQVFNV
YCKGSPEMLKKLCKPQSLPDNYSQQLSEFAKKGYRIIAIAFKALSHKMNYTKVQRLSREEVENNMEFLGFVILENRLKPD
TTKVINALNAAKIRTIMITGDNILTAISVARDCGIVSPSQSVITVHADPIGDSANIQTNTGTECNFDNSSDKHYKLHYTL
DLGSKTSRAYLFKSCFNSNLFDPETPEFTAQVGKTIFHMESTNSLVNESTSSYAESGLPTSDSLASVKTIDTWTHNDAEL
GIKHTPDESWRRQECIFAMDGKTWQIVKDYFPEEMEILLTRGSIYARMSPDQKQALVIELQNLDYCVAMCGDGANDCGAL
KVAHAGISLSETEASIASPFTSRNPTISAVLKVIKEGRAALVTSFGIFKYMAAYSLVQFISVMILYSIDSNLTDKQYLYV
DLGLISIFAFFFGKTESFDGMLVEQVPLSSLISSTPLASLLLHLTVVTAFQVTCWVHLHQQPWFKAFEPADEDHLGCFEN
YTMFCISSFQYIILAFVFSKGAPYRKPLWSNWPLCLAFIVNLCIIVYLVLYPSDWVASFFQLIVPPTMRFRYVMLAYGAA
SFICHIFVESFLVEYLVFKKYQVKREKNWVTSKQKYMRLEHDISNIKNWPPITEVYEPNNLIDCETEQPTYVSLHAEQNH
DTQLGKFPGFC
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0113417
5743
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0089449
4754
FBtr0089448
4435
FBtr0089446
2238
FBtr0089447
3219
FBtr0089445
2262
FBtr0089450
2234
FBtr0089451
4782
FBtr0333161
4447
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0088463
1314
FBpp0088462
1314
FBpp0088460
497
FBpp0088461
658
FBpp0088459
595
FBpp0088464
521
FBpp0089013
1388
FBpp0305364
1290
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG32000-PH
anne-PH
Name Synonyms
Secondary FlyBase IDs
    References (0)