Open Close
General Information
Symbol
Dmel\rl-PE
Species
D. melanogaster
Annotation Symbol
CG12559-PE
FlyBase ID
FBpp0112423
Associated gene
Length (aa)
376
Theoretical pI
5.98
Predicted MW (kDa)
43.2
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MEEFNSSGSVVNGTGSTEVPQSNAEVIRGQIFEVGPRYIKLAYIGEGAYGMVVSADDTLTNQRVAIKKISPFEHQTYCQR
TLREITILTRFKHENIIDIRDILRVDSIDQMRDVYIVQCLMETDLYKLLKTQRLSNDHICYFLYQILRGLKYIHSANVLH
RDLKPSNLLLNKTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPI
FPGKHYLDQLNHILGVLGSPSRDDLECIINEKARNYLESLPFKPNVPWAKLFPNADALALDLLGKMLTFNPHKRIPVEEA
LAHPYLEQYYDPGDEPVAEVPFRINMENDDISRDALKSLIFEETLKFKERQPDNAP
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0113700
1573
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0113701
1412
FBtr0113703
1614
FBtr0113702
1795
FBtr0329919
2347
FBtr0329920
6472
FBtr0345337
2072
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0112424
190
FBpp0112426
376
FBpp0112425
376
FBpp0302952
331
FBpp0302953
266
FBpp0311493
376
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/Swiss-Prot - Manually annotated and reviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
rl-PE
Name Synonyms
Secondary FlyBase IDs
    References (0)