Open Close
General Information
Symbol
Dmel\Sap130-PE
Species
D. melanogaster
Annotation Symbol
CG11006-PE
FlyBase ID
FBpp0112998
Associated gene
Length (aa)
1257
Theoretical pI
11.29
Predicted MW (kDa)
127.5
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MSAPSEGGAGGGPVGGGSTATAPSATGSLSASASLVSHSHPPLQLRGVINKYSLPSHLPSSAAHPAVAAKITHVKSDGGG
GISIAGTPILSGGTIKVASANQVQQTSLGGTPIALNAGQATTAASIRAIGAGGQSTQVRVVMPMIKQLENVTATGRTQIT
AIPAAPARSGANASITVTRPVTQATYLPRASVTATQMGGVGVGVGQRLVTPLRATSSATVTPTAPTVLSSTGGFVRGATA
SVSRSGVALTSQPSSAVISSSNSGAWMQSQGQVQLIRTIHQPRQRIITTSAGVSNASVVTTTPVQAPTALSVSAGQPLAT
QQATGPGGGPQAYVATVLPQRQHQATLVYSSNVSAPNASQNPGQQFNPRFAVATPTGGVTTTTPGGTTVTPRQVRPIPLG
KSFPTAKLNTTSISIRAPSIPQLNTSVTASPTAVSVSGGATVAPGRGPGAGGTALTATNLPTTRIIQLQQPATGTTQQII
GSGARLAGNVMLQPFLMSTTAAAKMGIRPPVTMTAKVQPSLTITQLNPIGKLSAGGGSGGQTMGPQGVASIQAVPVPNVS
ASVVNSSSVTGATSAAGGATVLPLTISGRGAGVGPGGNILTGTLTPIKNASGITLGKMMMAPASSAPGADGSSTSGATVT
GFQRTWNPVVASQSQLMKIDEKGSAATIYYESMPASASTGVLSLTTTTVTQSTQAQAQLVSSAGGSLSVSSLPFASHATA
GAGSGGGGSQATFTVLPSGAGGTATRTIGHQQLIIPAGPNSAPPQHMVIPLHTSVKVTTGAGNPQQATASGALVSSFMRK
RDAEGSPIRAAKNLGPTLLSMASNNSGQNMPPAPGTTFNIQPVSVTVPQSVGSGLTVEALAKKERERVTHGVASSAASVP
ATVGPVNSTRNSRADSPASSDGSTTVSANSSPGVDQQLQDRIGDQPATGGAGGRDNSTHFNPINEMYSSHQSIQQNLGHS
SLGARSGSSAFVDVQAPTPQQQQPQQVPHLVGSTQMQQGTRMNGTGNSSSSSYDCSSRKKPRRSTNDSQHSTQSQASLSL
PPPSSEPTPPAGASYMQKHNNGGLLVTAATPGVAPNSAPGDANHRNSTPAVAGNKENANPVDFVIRRPRNCALLNTYKPT
HKLANNHFHRYTDVKPREERRATVIDLANQPNVQGKINGWKIYHLRSQMEDLNESEVFSLGRLETMLQDLEKDKEKHSEI
ERVTELLKGNIQRSKIITDGINEAQNQLMKIFEHKPHVSNIITRCASKRNFKKREKI
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0114506
4060
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0075927
4045
FBtr0075928
4159
FBtr0075929
4270
FBtr0332043
4015
FBtr0332044
4018
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0075659
1219
FBpp0075660
1257
FBpp0075661
1294
FBpp0304353
1209
FBpp0304354
1210
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG11006-PE
Sap130-PE
Name Synonyms
Secondary FlyBase IDs
    References (0)